Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GABPB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit GABPB2 Polyclonal Antibody | anti-GABPB1 antibody

GABPB2 antibody - N-terminal region

Gene Names
GABPB1; E4TF1; GABPB; BABPB2; E4TF1B; GABPB2; NRF2B1; NRF2B2; GABPB-1; E4TF1-47; E4TF1-53
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GABPB2; Polyclonal Antibody; GABPB2 antibody - N-terminal region; anti-GABPB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGH
Sequence Length
360
Applicable Applications for anti-GABPB1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GABPB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GABPB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-GABPB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-GABPB1 antibody
This is a rabbit polyclonal antibody against GABPB2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GABPB2 is the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
GA-binding protein subunit beta-1 isoform gamma 1
NCBI Official Synonym Full Names
GA binding protein transcription factor subunit beta 1
NCBI Official Symbol
GABPB1
NCBI Official Synonym Symbols
E4TF1; GABPB; BABPB2; E4TF1B; GABPB2; NRF2B1; NRF2B2; GABPB-1; E4TF1-47; E4TF1-53
NCBI Protein Information
GA-binding protein subunit beta-1
UniProt Protein Name
GA-binding protein subunit beta-1
Protein Family
UniProt Gene Name
GABPB1
UniProt Synonym Gene Names
E4TF1B; GABPB; GABPB2; GABP subunit beta-1; GABPB-1; GABPB-2
UniProt Entry Name
GABP1_HUMAN

NCBI Description

This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GABPB1: Transcription factor capable of interacting with purine rich repeats (GA repeats). Necessary for the expression of the Adenovirus E4 gene. 4 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 15q21.2

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; protein heterodimerization activity; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; mitochondrion organization and biogenesis; transcription, DNA-dependent; organelle organization and biogenesis; positive regulation of transcription from RNA polymerase II promoter

Research Articles on GABPB1

Similar Products

Product Notes

The GABPB1 gabpb1 (Catalog #AAA3213605) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GABPB2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GABPB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GABPB1 gabpb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSLVDLGKKL LEAARAGQDD EVRILMANGA PFTTDWLGTS PLHLAAQYGH. It is sometimes possible for the material contained within the vial of "GABPB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.