Mouse anti-Human GPX5 Monoclonal Antibody | anti-GPX5 antibody

GPX5 (Epididymal Secretory Glutathione Peroxidase, Epididymis-specific Glutathione Peroxidase-like Protein, EGLP, Glutathione Peroxidase 5, GPx-5, GSHPx-5) (Biotin)

Cat. Num. AAA6142151

• Gene Names: GPX5; EGLP; GPx-5; GSHPx-5; HEL-S-75p
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GPX5; Monoclonal Antibody; GPX5 (Epididymal Secretory Glutathione Peroxidase; Epididymis-specific Glutathione Peroxidase-like Protein; EGLP; Glutathione Peroxidase 5; GPx-5; GSHPx-5) (Biotin); anti-GPX5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B9
• Specificity: Recognizes human GPX5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 221

• Applicable Applications for anti-GPX5 antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa122-221 from human GPX5 (NP_001500) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of GPX5 transfected lysate using GPX5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GPX5 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged GPX5 is 1ng/ml as a capture antibody.)

Related Product Information for anti-GPX5 antibody

Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.

Product Categories/Family for anti-GPX5 antibody

Antibodies; Enzymes; Peroxidase

NCBI and Uniprot Product Information

• NCBI GI #: 4557629
• NCBI GeneID: 2880
• NCBI Accession #: NP_001500
• NCBI GenBank Nucleotide #: NM_001509
• UniProt Accession #: O75715
• NCBI Official Full Name: epididymal secretory glutathione peroxidase isoform 1
• NCBI Official Synonym Full Names: glutathione peroxidase 5
• NCBI Official Symbol: GPX5
• NCBI Official Synonym Symbols: EGLP; GPx-5; GSHPx-5; HEL-S-75p
• NCBI Protein Information: epididymal secretory glutathione peroxidase
• UniProt Protein Name: Epididymal secretory glutathione peroxidase
• Protein Family: Probable glutathione peroxidase
• UniProt Gene Name: GPX5
• UniProt Synonym Gene Names: EGLP; GPx-5; GSHPx-5
• UniProt Entry Name: GPX5_HUMAN

NCBI Description

This gene belongs to the glutathione peroxidase family. It is specifically expressed in the epididymis in the mammalian male reproductive tract, and is androgen-regulated. Unlike several other characterized glutathione peroxidases, this enzyme is not a selenoprotein, lacking the selenocysteine residue. Thus, it is selenium-independent, and has been proposed to play a role in protecting the membranes of spermatozoa from the damaging effects of lipid peroxidation and/or preventing premature acrosome reaction. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2016]

Uniprot Description

GPX5: Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Belongs to the glutathione peroxidase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.11.1.9; Secreted, signal peptide; Other Amino Acids Metabolism - glutathione; Oxidoreductase; Lipid Metabolism - arachidonic acid; Secreted

Chromosomal Location of Human Ortholog: 6p22.1

Cellular Component: extracellular space

Molecular Function: glutathione peroxidase activity

Biological Process: response to oxidative stress; lipid metabolic process