Western Blot (WB)
(Western Blot analysis of LGALS12 expression in transfected 293T cell line by LGALS12 polyclonal antibody. Lane 1: LGALS12 transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human LGALS12 Polyclonal Antibody | anti-Lgals12 antibody
LGALS12 (Galectin-12, Gal-12, Galectin-related Inhibitor of Proliferation, GRIP1)
Gene Names
Lgals12; Grip1; AW987437
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
LGALS12; Polyclonal Antibody; LGALS12 (Galectin-12; Gal-12; Galectin-related Inhibitor of Proliferation; GRIP1); Anti -LGALS12 (Galectin-12; anti-Lgals12 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LGALS12.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLKLALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS
Applicable Applications for anti-Lgals12 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human LGALS12, aa1-336 (NP_149092.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of LGALS12 expression in transfected 293T cell line by LGALS12 polyclonal antibody. Lane 1: LGALS12 transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of LGALS12 expression in transfected 293T cell line by LGALS12 polyclonal antibody. Lane 1: LGALS12 transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-Lgals12 antibody
Binds lactose. May participate in the apoptosis of adipocytes.
Product Categories/Family for anti-Lgals12 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
35,460 Da
NCBI Official Full Name
Lgals12 protein
NCBI Official Synonym Full Names
lectin, galactose binding, soluble 12
NCBI Official Symbol
Lgals12
NCBI Official Synonym Symbols
Grip1; AW987437
NCBI Protein Information
galectin-12; gal-12; galectin-related inhibitor of proliferation 1
UniProt Protein Name
Galectin-12
Protein Family
UniProt Gene Name
Lgals12
UniProt Synonym Gene Names
Gal-12
UniProt Entry Name
LEG12_MOUSE
Uniprot Description
LGALS12: Binds lactose. May participate in the apoptosis of adipocytes. 6 isoforms of the human protein are produced by alternative splicing.
Cellular Component: mitochondrion; intracellular; nucleus
Molecular Function: lactose binding; carbohydrate binding
Biological Process: apoptosis
Research Articles on Lgals12
Similar Products
Product Notes
The Lgals12 lgals12 (Catalog #AAA6000036) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LGALS12 (Galectin-12, Gal-12, Galectin-related Inhibitor of Proliferation, GRIP1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LGALS12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the Lgals12 lgals12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSQPSGGRAP GTRIYSWSCP TVMSPGEKLD PIPDSFILQP PVFHPVVPYV TTIFGGLHAG KMVMLQGVVP LDAHRFQVDF QCGCSLCPRP DIAFHFNPRF HTTKPHVICN TLHGGRWQRE ARWPHLALRR GSSFLILFLF GNEEVKVSVN GQHFLHFRYR LPLSHVDTLG IFGDILVEAV GFLNINPFVE GSREYPAGHP FLLMSPRLEV PCSHALPQGL SPGQVIIVRG LVLQEPKHFT VSLRDQAAHA PVTLRASFAD RTLAWISRWG QKKLISAPFL FYPQRFFEVL LLFQEGGLKL ALNGQGLGAT SMNQQALEQL RELRISGSVQ LYCVHS. It is sometimes possible for the material contained within the vial of "LGALS12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
