Mouse GPR84 Monoclonal Antibody | anti-GPR84 antibody

GPR84 (G Protein-Coupled Receptor 84, EX33, GPCR4) (HRP)

Cat. Num. AAA6181837

• Gene Names: GPR84; EX33; GPCR4
• Applications: Western Blot
• Purity: Purified
• Synonyms: GPR84; Monoclonal Antibody; GPR84 (G Protein-Coupled Receptor 84; EX33; GPCR4) (HRP); G Protein-Coupled Receptor 84; GPCR4; anti-GPR84 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5C3
• Specificity: Recognizes GPR84.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-GPR84 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GPR84 (NP_065103, 208aa-316aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GPR84 is 1 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of GPR84 expression in transfected 293T cell line by GPR84 monoclonal antibody (M01), clone 5C3.Lane 1: GPR84 transfected lysate (Predicted MW: 43.7 KDa).Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-GPR84 antibody

Antibodies; G Protein Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 9966839
• NCBI GeneID: 53831
• NCBI Accession #: NP_065103
• NCBI GenBank Nucleotide #: NM_020370
• UniProt Accession #: Q9NQS5
• Molecular Weight: 44kDa
• NCBI Official Full Name: G-protein coupled receptor 84
• NCBI Official Synonym Full Names: G protein-coupled receptor 84
• NCBI Official Symbol: GPR84
• NCBI Official Synonym Symbols: EX33; GPCR4
• NCBI Protein Information: G-protein coupled receptor 84
• UniProt Protein Name: G-protein coupled receptor 84
• Protein Family: G-protein coupled receptor
• UniProt Gene Name: GPR84
• UniProt Synonym Gene Names: EX33
• UniProt Entry Name: GPR84_HUMAN

Uniprot Description

GPR84: Receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0) and lauric acid (C12:0) are the most potent agonists. Not activated by short-chain and long-chain saturated and unsaturated FFAs. Activation by medium-chain free fatty acid is coupled to a pertussis toxin sensitive G(i/o) protein pathway. May have important roles in processes from fatty acid metabolism to regulation of the immune system. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Motility/polarity/chemotaxis; GPCR, family 1; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: plasma membrane; integral to membrane; receptor complex

Molecular Function: G-protein coupled receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway