Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human GOT2 Monoclonal Antibody | anti-GOT2 antibody

GOT2 (Glutamic-oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2), Aspartate Aminotransferase, Mitochondrial, FABP-1, FABPpm, Fatty Acid-binding Protein, FLJ40994, Glutamate Oxaloacetate Transaminase 2, KAT4, KATIV, mAspAT, mitAAT, P

Gene Names
GOT2; KAT4; KATIV; KYAT4; mitAAT
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GOT2; Monoclonal Antibody; GOT2 (Glutamic-oxaloacetic Transaminase 2; Mitochondrial (Aspartate Aminotransferase 2); Aspartate Aminotransferase; Mitochondrial; FABP-1; FABPpm; Fatty Acid-binding Protein; FLJ40994; Glutamate Oxaloacetate Transaminase 2; KAT4; KATIV; mAspAT; mitAAT; P; anti-GOT2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4H8
Specificity
Recognizes human GOT2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GOT2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa331-430 from human GOT2 (NP_002071) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(GOT2 monoclonal antibody. Western Blot analysis of GOT2 expression in HepG2.)

Western Blot (WB) (GOT2 monoclonal antibody. Western Blot analysis of GOT2 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged GOT2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GOT2 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-GOT2 antibody
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
Product Categories/Family for anti-GOT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,030 Da
NCBI Official Full Name
aspartate aminotransferase, mitochondrial isoform 1
NCBI Official Synonym Full Names
glutamic-oxaloacetic transaminase 2
NCBI Official Symbol
GOT2
NCBI Official Synonym Symbols
KAT4; KATIV; KYAT4; mitAAT
NCBI Protein Information
aspartate aminotransferase, mitochondrial
UniProt Protein Name
Aspartate aminotransferase, mitochondrial
UniProt Gene Name
GOT2
UniProt Synonym Gene Names
mAspAT; FABP-1; FABPpm
UniProt Entry Name
AATM_HUMAN

NCBI Description

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2013]

Research Articles on GOT2

Similar Products

Product Notes

The GOT2 got2 (Catalog #AAA6131532) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GOT2 (Glutamic-oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2), Aspartate Aminotransferase, Mitochondrial, FABP-1, FABPpm, Fatty Acid-binding Protein, FLJ40994, Glutamate Oxaloacetate Transaminase 2, KAT4, KATIV, mAspAT, mitAAT, P reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GOT2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GOT2 got2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GOT2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.