Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse GNAQ Monoclonal Antibody | anti-GNAQ antibody

GNAQ (Guanine Nucleotide-binding Protein G(q) Subunit alpha, Guanine Nucleotide-binding Protein alpha-q, GAQ) (PE)

Gene Names
GNAQ; GAQ; SWS; CMC1; G-ALPHA-q
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GNAQ; Monoclonal Antibody; GNAQ (Guanine Nucleotide-binding Protein G(q) Subunit alpha; Guanine Nucleotide-binding Protein alpha-q; GAQ) (PE); anti-GNAQ antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B9
Specificity
Recognizes human GNAQ. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GNAQ antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa101-200 from human GNAQ (NP_002063) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVI
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged GNAQ is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GNAQ is 1ng/ml as a capture antibody.)
Related Product Information for anti-GNAQ antibody
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells (in vitro).
Product Categories/Family for anti-GNAQ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,142 Da
NCBI Official Full Name
guanine nucleotide-binding protein G(q) subunit alpha
NCBI Official Synonym Full Names
G protein subunit alpha q
NCBI Official Symbol
GNAQ
NCBI Official Synonym Symbols
GAQ; SWS; CMC1; G-ALPHA-q
NCBI Protein Information
guanine nucleotide-binding protein G(q) subunit alpha
UniProt Protein Name
Guanine nucleotide-binding protein G(q) subunit alpha
UniProt Gene Name
GNAQ
UniProt Synonym Gene Names
GAQ
UniProt Entry Name
GNAQ_HUMAN

Uniprot Description

G-alpha(q): a guanine nucleotide-binding protein of the G12 class of G-alpha proteins. Agonist binding to Gq-coupled receptors may block Akt activation via the release of active G-alpha(q) subunits that inhibit phosphatidylinositol 3-kinase. Heterotrimeric G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site.

Protein type: G protein; G protein, heterotrimeric; G protein, heterotrimeric alpha G(q)

Chromosomal Location of Human Ortholog: 9q21

Cellular Component: cytoplasm; lysosomal membrane; photoreceptor outer segment; plasma membrane

Molecular Function: GTPase activator activity; GTPase activity; protein binding; type 2A serotonin receptor binding

Biological Process: acetylcholine receptor signaling, muscarinic pathway; blood coagulation; dopamine receptor, phospholipase C activating pathway; entrainment of circadian clock; G-protein signaling, adenylate cyclase activating pathway; glutamate signaling pathway; negative regulation of protein kinase activity; phospholipase C activation; phototransduction, visible light; platelet activation; protein stabilization; regulation of action potential

Disease: Capillary Malformations, Congenital; Sturge-weber Syndrome

Similar Products

Product Notes

The GNAQ gnaq (Catalog #AAA6158024) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GNAQ (Guanine Nucleotide-binding Protein G(q) Subunit alpha, Guanine Nucleotide-binding Protein alpha-q, GAQ) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GNAQ can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GNAQ gnaq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GNAQ, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.