Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (69.74kD).)

Mouse anti-Human GMR-alpha Monoclonal Antibody | anti-GMR-alpha antibody

GMR-alpha (CD116, Granulocyte-macrophage Colony-stimulating Factor Receptor Subunit alpha, GM-CSF-R-alpha, GMCSFR-alpha, CDw116, CSF2RA, CSF2R, CSF2RY) (PE)

Gene Names
CSF2RA; GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; GM-CSF-R-alpha
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GMR-alpha; Monoclonal Antibody; GMR-alpha (CD116; Granulocyte-macrophage Colony-stimulating Factor Receptor Subunit alpha; GM-CSF-R-alpha; GMCSFR-alpha; CDw116; CSF2RA; CSF2R; CSF2RY) (PE); anti-GMR-alpha antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G5
Specificity
Recognizes human CSF2RA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GMR-alpha antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-400 from human CSF2RA (AAH02635.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (69.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (69.74kD).)

Western Blot (WB)

(Western Blot analysis of CSF2RA expression in transfected 293T cell line by CSF2RA monoclonal antibody. Lane 1: CSF2RA transfected lysate.)

Western Blot (WB) (Western Blot analysis of CSF2RA expression in transfected 293T cell line by CSF2RA monoclonal antibody. Lane 1: CSF2RA transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CSF2RA is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CSF2RA is 3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between KIT and CSF2RA. HeLa cells were stained with KIT rabbit purified polyclonal 1:1200 and CSF2RA mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between KIT and CSF2RA. HeLa cells were stained with KIT rabbit purified polyclonal 1:1200 and CSF2RA mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-GMR-alpha antibody
CD116 is a 70-85kD a chain of the GM-CSF receptor. It combines with CDw131 B chain to form the high affinity GM-CSF receptor. A soluble form of CD116, which binds GM-CSF with a relatively low affinity, has been identified. In addition, an alternatively spliced form of CD116 with an altered cytoplasmic tail has been described. CD116 is expressed on various myeloid cells including monocytes, macrophages, neutrophils, eosinophils, dendritic cells and their precursors, fibroblasts, and endothelial cells. CD116 is expressed on myeloid leukemias, osteogenic sarcoma cell lines, osteoblast-like cells and breast and lung carcinoma cell lines.
Product Categories/Family for anti-GMR-alpha antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
31,101 Da
NCBI Official Full Name
Homo sapiens colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage), mRNA
NCBI Official Synonym Full Names
colony stimulating factor 2 receptor alpha subunit
NCBI Official Symbol
CSF2RA
NCBI Official Synonym Symbols
GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; GM-CSF-R-alpha
NCBI Protein Information
granulocyte-macrophage colony-stimulating factor receptor subunit alpha

NCBI Description

The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq, Jul 2008]

Research Articles on GMR-alpha

Similar Products

Product Notes

The GMR-alpha (Catalog #AAA6158019) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GMR-alpha (CD116, Granulocyte-macrophage Colony-stimulating Factor Receptor Subunit alpha, GM-CSF-R-alpha, GMCSFR-alpha, CDw116, CSF2RA, CSF2R, CSF2RY) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GMR-alpha can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GMR-alpha for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GMR-alpha, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.