Mouse anti-Human GMR-alpha Monoclonal Antibody | anti-GMR-alpha antibody

GMR-alpha (CD116, Granulocyte-macrophage Colony-stimulating Factor Receptor Subunit alpha, GM-CSF-R-alpha, GMCSFR-alpha, CDw116, CSF2RA, CSF2R, CSF2RY) (FITC)

Cat. Num. AAA6147413

• Gene Names: CSF2RA; GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; GM-CSF-R-alpha
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GMR-alpha; Monoclonal Antibody; GMR-alpha (CD116; Granulocyte-macrophage Colony-stimulating Factor Receptor Subunit alpha; GM-CSF-R-alpha; GMCSFR-alpha; CDw116; CSF2RA; CSF2R; CSF2RY) (FITC); anti-GMR-alpha antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G5
• Specificity: Recognizes human CSF2RA.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-GMR-alpha antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-400 from human CSF2RA (AAH02635.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (69.74kD).)

Western Blot (WB)

(Western Blot analysis of CSF2RA expression in transfected 293T cell line by CSF2RA monoclonal antibody. Lane 1: CSF2RA transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CSF2RA is 3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between KIT and CSF2RA. HeLa cells were stained with KIT rabbit purified polyclonal 1:1200 and CSF2RA mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-GMR-alpha antibody

CD116 is a 70-85kD a chain of the GM-CSF receptor. It combines with CDw131 B chain to form the high affinity GM-CSF receptor. A soluble form of CD116, which binds GM-CSF with a relatively low affinity, has been identified. In addition, an alternatively spliced form of CD116 with an altered cytoplasmic tail has been described. CD116 is expressed on various myeloid cells including monocytes, macrophages, neutrophils, eosinophils, dendritic cells and their precursors, fibroblasts, and endothelial cells. CD116 is expressed on myeloid leukemias, osteogenic sarcoma cell lines, osteoblast-like cells and breast and lung carcinoma cell lines.

Product Categories/Family for anti-GMR-alpha antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 12803600
• NCBI GeneID: 1438
• Molecular Weight: 31,101 Da
• NCBI Official Full Name: Homo sapiens colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage), mRNA
• NCBI Official Synonym Full Names: colony stimulating factor 2 receptor alpha subunit
• NCBI Official Symbol: CSF2RA
• NCBI Official Synonym Symbols: GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; GM-CSF-R-alpha
• NCBI Protein Information: granulocyte-macrophage colony-stimulating factor receptor subunit alpha

NCBI Description

The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq, Jul 2008]