Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human GluR1 Monoclonal Antibody | anti-GluR1 antibody

GluR1 (Glutamate Receptor 1, GluR-1, AMPA-selective Glutamate Receptor 1, GLUH1, GLURA, GluR-A, GluR-K1, Glutamate Receptor Ionotropic AMPA 1, GluA1, GRIA1, HBGR1, MGC133252) (MaxLight 550)

Gene Names
GRIA1; GLUH1; GLUR1; GLURA; GluA1; HBGR1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GluR1; Monoclonal Antibody; GluR1 (Glutamate Receptor 1; GluR-1; AMPA-selective Glutamate Receptor 1; GLUH1; GLURA; GluR-A; GluR-K1; Glutamate Receptor Ionotropic AMPA 1; GluA1; GRIA1; HBGR1; MGC133252) (MaxLight 550); anti-GluR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G10
Specificity
Recognizes human GRIA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
906
Applicable Applications for anti-GluR1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa201-300 from human GRIA1 (NP_000818) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GluR1 antibody
MaxLight550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor546, 555, DyLight549, Cy3, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Product Categories/Family for anti-GluR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
glutamate receptor 1 isoform 1
NCBI Official Synonym Full Names
glutamate ionotropic receptor AMPA type subunit 1
NCBI Official Symbol
GRIA1
NCBI Official Synonym Symbols
GLUH1; GLUR1; GLURA; GluA1; HBGR1
NCBI Protein Information
glutamate receptor 1
UniProt Protein Name
Glutamate receptor 1
UniProt Gene Name
GRIA1
UniProt Synonym Gene Names
GLUH1; GLUR1; GluR-1; GluA1
UniProt Entry Name
GRIA1_HUMAN

NCBI Description

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GluR1: an integral membrane protein belonging to the glutamate-gated ion channel family. L-glutamate (Glu) acts as an excitatory neurotransmitter at many synapses in the central nervous system. Glutamate receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. Each of the four GluR proteins (GRIA1-4) include flip and flop isoforms generated by alternative RNA splicing. Expressed in granule and pyramidal cells in the hippocampal formation.

Protein type: Membrane protein, integral; Channel, ligand-gated; Channel, calcium; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: postsynaptic membrane; synaptic vesicle; endoplasmic reticulum membrane; recycling endosome; cell surface; cell soma; postsynaptic density; dendrite; dendritic spine; plasma membrane; cell junction

Molecular Function: protein binding; extracellular-glutamate-gated ion channel activity; alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity; glutamate receptor activity; PDZ domain binding

Biological Process: synaptic transmission, glutamatergic; synaptic transmission; long-term memory; ionotropic glutamate receptor signaling pathway; receptor internalization; signal transduction

Research Articles on GluR1

Similar Products

Product Notes

The GluR1 gria1 (Catalog #AAA6211697) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GluR1 (Glutamate Receptor 1, GluR-1, AMPA-selective Glutamate Receptor 1, GLUH1, GLURA, GluR-A, GluR-K1, Glutamate Receptor Ionotropic AMPA 1, GluA1, GRIA1, HBGR1, MGC133252) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GluR1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GluR1 gria1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GluR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.