Mouse GLUL Monoclonal Antibody | anti-GLUL antibody

GLUL (Glutamate-Ammonia Ligase (Glutamine Synthetase), GLNS, GS, PIG43, PIG59) (AP)

Cat. Num. AAA6161601

• Gene Names: GLUL; GS; GLNS; PIG43; PIG59
• Applications: Western Blot
• Purity: Purified
• Synonyms: GLUL; Monoclonal Antibody; GLUL (Glutamate-Ammonia Ligase (Glutamine Synthetase); GLNS; GS; PIG43; PIG59) (AP); Glutamate-Ammonia Ligase (Glutamine Synthetase); PIG59; anti-GLUL antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B6
• Specificity: Recognizes GLUL.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-GLUL antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GLUL (NP_002056, 274aa-373aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GLUL monoclonal antibody (M02), clone 3B6 Western Blot analysis of GLUL expression in Jurkat.)

Western Blot (WB)

(GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged GLUL is approximately 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in PC-12.)

Western Blot (WB)

(GLUL monoclonal antibody (M02), clone 3B6. Western Blot analysis of GLUL expression in Raw 264.7.)

Western Blot (WB)

(Western Blot analysis of GLUL expression in transfected 293T cell line by GLUL monoclonal antibody (M02), clone 3B6.Lane 1: GLUL transfected lysate(42.1 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-GLUL antibody

Glutamine is a main source of energy and is involved in cell proliferation, inhibition of apoptosis, and cell signaling (Haberle et al., 2005 [PubMed 16267323]). Fetal glutamine requirements are very high and depend largely on active glutamine synthesis and the release of glutamine into the fetal circulation by the placenta. Glutamine synthetase (EC 6.3.1.2), also called glutamate-ammonia ligase (GLUL), is expressed throughout the body and plays an important role in controlling body pH and in removing ammonia from the circulation. The enzyme clears L-glutamate, the major neurotransmitter in the central nervous system, from neuronal synapses (see references in Clancy et al., 1996 [PubMed 8975719]). [supplied by OMIM]

Product Categories/Family for anti-GLUL antibody

Antibodies; Enzymes; Decarboxylase

References

1. Optimisation of the quantification of glutamine synthetase and myelin basic protein in cerebrospinal fluid by a combined acidification and neutralisation protocol. Herbert MK, Kuiperij HB, Verbeek MM.J Immunol Methods. 2012 Apr 19.

NCBI and Uniprot Product Information

• NCBI GI #: 19923206
• NCBI GeneID: 2752
• NCBI Accession #: NP_002056
• NCBI GenBank Nucleotide #: NM_002065
• UniProt Accession #: P15104
• Molecular Weight: 42kDa
• NCBI Official Full Name: glutamine synthetase
• NCBI Official Synonym Full Names: glutamate-ammonia ligase
• NCBI Official Symbol: GLUL
• NCBI Official Synonym Symbols: GS; GLNS; PIG43; PIG59
• NCBI Protein Information: glutamine synthetase
• UniProt Protein Name: Glutamine synthetase
• UniProt Gene Name: GLUL
• UniProt Synonym Gene Names: GLNS; GS
• UniProt Entry Name: GLNA_HUMAN

NCBI Description

The protein encoded by this gene belongs to the glutamine synthetase family. It catalyzes the synthesis of glutamine from glutamate and ammonia in an ATP-dependent reaction. This protein plays a role in ammonia and glutamate detoxification, acid-base homeostasis, cell signaling, and cell proliferation. Glutamine is an abundant amino acid, and is important to the biosynthesis of several amino acids, pyrimidines, and purines. Mutations in this gene are associated with congenital glutamine deficiency, and overexpression of this gene was observed in some primary liver cancer samples. There are six pseudogenes of this gene found on chromosomes 2, 5, 9, 11, and 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

Uniprot Description

GLUL: This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner. Essential for proliferation of fetal skin fibroblasts. Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD). CSGD is a rare developmental disorder with severe brain malformation resulting in multi-organ failure and neonatal death. Glutamine is largely absent from affected patients serum, urine and cerebrospinal fluid. Belongs to the glutamine synthetase family.

Protein type: Amino Acid Metabolism - arginine and proline; EC 6.3.1.2; Ligase; EC 4.1.1.15; Amino Acid Metabolism - alanine, aspartate and glutamate; Energy Metabolism - nitrogen

Chromosomal Location of Human Ortholog: 1q31

Cellular Component: protein complex; mitochondrion; rough endoplasmic reticulum; cytoplasm; perikaryon; nerve terminal; nucleus; cytosol

Molecular Function: glutamate-ammonia ligase activity; identical protein binding; glutamate binding; dynein light chain binding; glutamate decarboxylase activity; manganese ion binding; magnesium ion binding; ATP binding

Biological Process: synaptic transmission; glutamate catabolic process; cell proliferation; glutamine biosynthetic process; response to glucose stimulus; positive regulation of insulin secretion; neurotransmitter uptake; amino acid biosynthetic process; cellular response to starvation; positive regulation of synaptic transmission, glutamatergic; protein homooligomerization; positive regulation of epithelial cell proliferation

Disease: Glutamine Deficiency, Congenital