Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human GLIPR1 Monoclonal Antibody | anti-GLIPR1 antibody

GLIPR1 (Glioma Pathogenesis-related Protein 1, GliPR 1, Protein RTVP-1, GLIPR, RTVP1) (MaxLight 750)

Gene Names
GLIPR1; GLIPR; RTVP1; CRISP7
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GLIPR1; Monoclonal Antibody; GLIPR1 (Glioma Pathogenesis-related Protein 1; GliPR 1; Protein RTVP-1; GLIPR; RTVP1) (MaxLight 750); anti-GLIPR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8D9
Specificity
Recognizes human GLIPR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-GLIPR1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa23-100 from human GLIPR1 (NP_006842) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GLIPR1 antibody
This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Product Categories/Family for anti-GLIPR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 29 kDa

Observed: 24 kDa
NCBI Official Full Name
glioma pathogenesis-related protein 1
NCBI Official Synonym Full Names
GLI pathogenesis-related 1
NCBI Official Symbol
GLIPR1
NCBI Official Synonym Symbols
GLIPR; RTVP1; CRISP7
NCBI Protein Information
glioma pathogenesis-related protein 1; gliPR 1; protein RTVP-1; GLI pathogenesis-related 1 (glioma); testes-specific vespid and pathogenesis protein 1; related to testis-specific, vespid, and pathogenesis proteins 1
UniProt Protein Name
Glioma pathogenesis-related protein 1
Protein Family
UniProt Gene Name
GLIPR1
UniProt Synonym Gene Names
GLIPR; RTVP1; GliPR 1
UniProt Entry Name
GLIP1_HUMAN

NCBI Description

This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

GLIPR1: a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q21.2

Cellular Component: membrane; plasma membrane; integral to membrane; extracellular region

Biological Process: cellular lipid metabolic process

Research Articles on GLIPR1

Similar Products

Product Notes

The GLIPR1 glipr1 (Catalog #AAA6233040) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GLIPR1 (Glioma Pathogenesis-related Protein 1, GliPR 1, Protein RTVP-1, GLIPR, RTVP1) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GLIPR1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GLIPR1 glipr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GLIPR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.