Mouse anti-Human GLIPR1 Monoclonal Antibody | anti-GLIPR1 antibody

GLIPR1 (Glioma Pathogenesis-related Protein 1, GliPR 1, Protein RTVP-1, GLIPR, RTVP1) (Biotin)

Cat. Num. AAA6142083

• Gene Names: GLIPR1; GLIPR; RTVP1; CRISP7
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GLIPR1; Monoclonal Antibody; GLIPR1 (Glioma Pathogenesis-related Protein 1; GliPR 1; Protein RTVP-1; GLIPR; RTVP1) (Biotin); anti-GLIPR1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8D9
• Specificity: Recognizes human GLIPR1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-GLIPR1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa23-100 from human GLIPR1 (NP_006842) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GLIPR1 monoclonal antibody Western Blot analysis of GLIPR1 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged GLIPR1 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-GLIPR1 antibody

This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

Product Categories/Family for anti-GLIPR1 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 110825980
• NCBI GeneID: 11010
• NCBI Accession #: NP_006842
• NCBI GenBank Nucleotide #: NM_006851
• UniProt Accession #: P48060; Q15409; Q969K2; A7YET6; F8VUC2
• Molecular Weight: Predicted: 29 kDa; ; Observed: 24 kDa
• NCBI Official Full Name: glioma pathogenesis-related protein 1
• NCBI Official Synonym Full Names: GLI pathogenesis-related 1
• NCBI Official Symbol: GLIPR1
• NCBI Official Synonym Symbols: GLIPR; RTVP1; CRISP7
• NCBI Protein Information: glioma pathogenesis-related protein 1; gliPR 1; protein RTVP-1; GLI pathogenesis-related 1 (glioma); testes-specific vespid and pathogenesis protein 1; related to testis-specific, vespid, and pathogenesis proteins 1
• UniProt Protein Name: Glioma pathogenesis-related protein 1
• Protein Family: GLIPR1-like protein
• UniProt Gene Name: GLIPR1
• UniProt Synonym Gene Names: GLIPR; RTVP1; GliPR 1
• UniProt Entry Name: GLIP1_HUMAN

NCBI Description

This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

GLIPR1: a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q21.2

Cellular Component: membrane; plasma membrane; integral to membrane; extracellular region

Biological Process: cellular lipid metabolic process