Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human GLB1 Monoclonal Antibody | anti-GLB1 antibody

GLB1 (Beta-galactosidase, Acid beta-galactosidase, Lactase, Elastin Receptor 1, ELNR1) (Biotin)

Gene Names
GLB1; EBP; ELNR1; MPS4B
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GLB1; Monoclonal Antibody; GLB1 (Beta-galactosidase; Acid beta-galactosidase; Lactase; Elastin Receptor 1; ELNR1) (Biotin); anti-GLB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6E7
Specificity
Recognizes human GLB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GLB1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa578-677 from human GLB1 (NP_000395) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(GLB1 monoclonal antibody, Western Blot analysis of GLB1 expression in HeLa.)

Western Blot (WB) (GLB1 monoclonal antibody, Western Blot analysis of GLB1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of GLB1 expression in transfected 293T cell line by GLB1 monoclonal antibody. Lane 1: GLB1 transfected lysate (76.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GLB1 expression in transfected 293T cell line by GLB1 monoclonal antibody. Lane 1: GLB1 transfected lysate (76.1kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of GLB1 transfected lysate using GLB1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GLB1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of GLB1 transfected lysate using GLB1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GLB1 rabbit polyclonal antibody.)
Related Product Information for anti-GLB1 antibody
GLB1, a 60-76kD glycoprotein, is a lysosomal B-galactosidase that hydrolyzes the terminal B-galactose from ganglioside and keratan sulfate. Defects in this gene are the causes of lysosomal storage diseases for GM1-gangliosidosis and Morquio B syndrome. In GM1 gangliosidosis, GM1 ganglioside accumulates in the neurons of the central nervous system, because of the deficiency (0±3% of normal) of lysosomal B-galactosidase activity. GM1 gangliosidosis demonstrates varying degrees of clinical severity but is invariably fatal, and children with the most common and severe form of GM1 gangliosidosis usually die within 3 years of birth. Morquio B syndrome patients are neurologically normal, but display severe skeletal dysostosis multiplex because of an accumulation of keratan sulfate. More than 100 mutations have been identified for GLB1, which result in different residual activities of the mutant enzymes and a spectrum of symptoms in the two related diseases. In lysosome, the mature B-galactosidase protein associates with cathepsin A and neuraminidase 1 to form the lysosomal multienzyme complex. An alternative splicing at the RNA level of GLB1 results a catalytically inactive B-galactosidase (also called elastin-binding protein) that plays an important role in vascular development.
Product Categories/Family for anti-GLB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74.6kDa (662aa) 70-100KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
beta-galactosidase isoform a preproprotein
NCBI Official Synonym Full Names
galactosidase beta 1
NCBI Official Symbol
GLB1
NCBI Official Synonym Symbols
EBP; ELNR1; MPS4B
NCBI Protein Information
beta-galactosidase
UniProt Protein Name
Beta-galactosidase
Protein Family
UniProt Gene Name
GLB1
UniProt Synonym Gene Names
ELNR1; Lactase
UniProt Entry Name
BGAL_HUMAN

NCBI Description

This gene encodes a member of the glycosyl hydrolase 35 family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature lysosomal enzyme. This enzyme catalyzes the hydrolysis of a terminal beta-linked galactose residue from ganglioside substrates and other glycoconjugates. Mutations in this gene may result in GM1-gangliosidosis and Morquio B syndrome. [provided by RefSeq, Nov 2015]

Uniprot Description

GLB1: Cleaves beta-linked terminal galactosyl residues from gangliosides, glycoproteins, and glycosaminoglycans. Defects in GLB1 are the cause of GM1-gangliosidosis type 1 (GM1G1); also known as infantile GM1- gangliosidosis. GM1-gangliosidosis is an autosomal recessive lysosomal storage disease marked by the accumulation of GM1 gangliosides, glycoproteins and keratan sulfate primarily in neurons of the central nervous system. GM1G1 is characterized by onset within the first three months of life, central nervous system degeneration, coarse facial features, hepatosplenomegaly, skeletal dysmorphology reminiscent of Hurler syndrome, and rapidly progressive psychomotor deterioration. Urinary oligosaccharide levels are high. It leads to death usually between the first and second year of life. Defects in GLB1 are the cause of GM1-gangliosidosis type 2 (GM1G2); also known as late infantile/juvenile GM1- gangliosidosis. GM1G2 is characterized by onset between ages 1 and 5. The main symptom is locomotor ataxia, ultimately leading to a state of decerebration with epileptic seizures. Patients do not display the skeletal changes associated with the infantile form, but they nonetheless excrete elevated amounts of beta-linked galactose-terminal oligosaccharides. Inheritance is autosomal recessive. Defects in GLB1 are the cause of GM1-gangliosidosis type 3 (GM1G3); also known as adult or chronic GM1- gangliosidosis. GM1G3 is characterized by a variable phenotype. Patients show mild skeletal abnormalities, dysarthria, gait disturbance, dystonia and visual impairment. Visceromegaly is absent. Intellectual deficit can initially be mild or absent but progresses over time. Inheritance is autosomal recessive. Defects in GLB1 are the cause of mucopolysaccharidosis type 4B (MPS4B); also known as Morquio syndrome B. MPS4B is a form of mucopolysaccharidosis type 4, an autosomal recessive lysosomal storage disease characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate. Key clinical features include short stature, skeletal dysplasia, dental anomalies, and corneal clouding. Intelligence is normal and there is no direct central nervous system involvement, although the skeletal changes may result in neurologic complications. There is variable severity, but patients with the severe phenotype usually do not survive past the second or third decade of life. Belongs to the glycosyl hydrolase 35 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Glycan Metabolism - other glycan degradation; Glycan Metabolism - glycosphingolipid biosynthesis - ganglio series; Glycan Metabolism - glycosaminoglycan degradation; Lipid Metabolism - sphingolipid; EC 3.2.1.23; Carbohydrate Metabolism - galactose; Hydrolase

Chromosomal Location of Human Ortholog: 3p21.33

Cellular Component: Golgi apparatus; lysosomal lumen; perinuclear region of cytoplasm; cytoplasm; vacuole

Molecular Function: protein binding; galactoside binding; beta-galactosidase activity

Biological Process: keratan sulfate metabolic process; sphingolipid metabolic process; dolichol-linked oligosaccharide biosynthetic process; glycosaminoglycan metabolic process; pathogenesis; post-translational protein modification; galactose catabolic process; glycosaminoglycan catabolic process; cellular protein metabolic process; carbohydrate metabolic process; protein amino acid N-linked glycosylation via asparagine; glycosphingolipid metabolic process; cellular carbohydrate metabolic process; keratan sulfate catabolic process

Disease: Gm1-gangliosidosis, Type Iii; Mucopolysaccharidosis Type Ivb; Gm1-gangliosidosis, Type Ii; Gm1-gangliosidosis, Type I

Research Articles on GLB1

Similar Products

Product Notes

The GLB1 glb1 (Catalog #AAA6142080) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GLB1 (Beta-galactosidase, Acid beta-galactosidase, Lactase, Elastin Receptor 1, ELNR1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GLB1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GLB1 glb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GLB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.