Mouse GJA8 Monoclonal Antibody | anti-GJA8 antibody

GJA8 (Gap Junction Protein, alpha 8, 50kD, CAE, CAE1, CX50, CZP1, MP70) (FITC)

Cat. Num. AAA6179068

• Gene Names: GJA8; CAE; CAE1; CX50; CZP1; MP70; CTRCT1
• Applications: Western Blot
• Purity: Purified
• Synonyms: GJA8; Monoclonal Antibody; GJA8 (Gap Junction Protein; alpha 8; 50kD; CAE; CAE1; CX50; CZP1; MP70) (FITC); Gap Junction Protein; MP70; anti-GJA8 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8A10
• Specificity: Recognizes GJA8.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-GJA8 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GJA8 (NP_005258, 301aa-410aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTT
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GJA8 is 0.03 ng/ml as a capture antibody.)

Related Product Information for anti-GJA8 antibody

Mouse monoclonal antibody raised against a partial recombinant GJA8.

Product Categories/Family for anti-GJA8 antibody

Antibodies; Connexin; Junction Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 55953076
• NCBI GeneID: 2703
• NCBI Accession #: NP_005258
• NCBI GenBank Nucleotide #: NM_005267
• UniProt Accession #: P48165
• Molecular Weight: 48kDa
• NCBI Official Full Name: gap junction alpha-8 protein
• NCBI Official Synonym Full Names: gap junction protein alpha 8
• NCBI Official Symbol: GJA8
• NCBI Official Synonym Symbols: CAE; CAE1; CX50; CZP1; MP70; CTRCT1
• NCBI Protein Information: gap junction alpha-8 protein
• UniProt Protein Name: Gap junction alpha-8 protein
• Protein Family: Gap junction alpha-8 protein
• UniProt Gene Name: GJA8
• UniProt Synonym Gene Names: Cx50
• UniProt Entry Name: CXA8_HUMAN

NCBI Description

This gene encodes a transmembrane connexin protein that is necessary for lens growth and maturation of lens fiber cells. The encoded protein is a component of gap junction channels and functions in a calcium and pH-dependent manner. Mutations in this gene have been associated with zonular pulverulent cataracts, nuclear progressive cataracts, and cataract-microcornea syndrome. [provided by RefSeq, Dec 2009]