Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human RING Finger Protein 111 Monoclonal Antibody | anti-RNF111 antibody

RING Finger Protein 111 (RNF111, E3 Ubiquitin-protein Ligase Arkadia, ARK) (Biotin)

Gene Names
RNF111; ARK; hRNF111
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RING Finger Protein 111; Monoclonal Antibody; RING Finger Protein 111 (RNF111; E3 Ubiquitin-protein Ligase Arkadia; ARK) (Biotin); EC=6.3.2.-; DKFZp313E0731; DKFZp686H1966; DKFZp761D081; FLJ38008; anti-RNF111 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C4
Specificity
Recognizes human RNF111.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
986
Applicable Applications for anti-RNF111 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-109 from human RNF111 (NP_060080) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNC
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(Western Blot analysis of RNF111 expression in transfected 293T cell line by RNF111 monoclonal antibody. Lane 1: RNF111 transfected lysate (107.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RNF111 expression in transfected 293T cell line by RNF111 monoclonal antibody. Lane 1: RNF111 transfected lysate (107.8kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RNF111 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RNF111 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged RNF111 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RNF111 is 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of RNF111 over-expressed 293 cell line, cotransfected with RNF111 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF111 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of RNF111 over-expressed 293 cell line, cotransfected with RNF111 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF111 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-RNF111 antibody
References
1. RB1CC1 positively regulates transforming growth factor-{beta} signaling through the modulation of Arkadia E3 ubiquitin ligase activity. Koinuma D, Shinozaki M, Nagano Y, Ikushima H, Horiguchi K, Goto K, Chano T, Saitoh M, Imamura T, Miyazono K, Miyazawa K.J Biol Chem. 2011 Jul 27. 2. Efficient TGF-beta/SMAD signaling in human melanoma cells associated with high c-SKI/SnoN expression. Javelaud D, van Kempen L, Alexaki VI, Le Scolan E, Luo K, Mauviel A.Mol Cancer. 2011 Jan 6;10(1):2. 3. Context-dependent regulation of the expression of c-Ski protein by Arkadia in human cancer cells. Nagano Y, Koinuma D, Miyazawa K, Miyazono K.J Biochem. 2010 Apr;147(4):545-54. Epub 2009 Dec 2. 4. Overexpression of snon/skil, amplified at the 3q26.2 locus, in ovarian cancers: a role in ovarian pathogenesis. Nanjundan M, Cheng KW, Zhang F, Lahad J, Kuo WL, Schmandt R, Smith-McCune K, Fishman D, Gray JW, Mills GB.Mol Oncol. 2008 Aug;2(2):164-81. Epub 2008 May 10. 5. Arkadia activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation. Levy L, Howell M, Das D, Harkin S, Episkopou V, Hill CS.Mol Cell Biol. 2007 Sep;27(17):6068-83. Epub 2007 Jun 25.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
E3 ubiquitin-protein ligase Arkadia isoform 2
NCBI Official Synonym Full Names
ring finger protein 111
NCBI Official Symbol
RNF111
NCBI Official Synonym Symbols
ARK; hRNF111
NCBI Protein Information
E3 ubiquitin-protein ligase Arkadia
UniProt Protein Name
E3 ubiquitin-protein ligase Arkadia
UniProt Gene Name
RNF111
UniProt Entry Name
RN111_HUMAN

NCBI Description

The protein encoded by this gene is a nuclear RING-domain containing E3 ubiquitin ligase. This protein interacts with the transforming growth factor (TGF) -beta/NODAL signaling pathway by promoting the ubiquitination and proteosomal degradation of negative regulators, like SMAD proteins, and thereby enhances TGF-beta target-gene transcription. As a modulator of the nodal signaling cascade, this gene plays a critical role in the induction of mesoderm during embryonic development. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012]

Uniprot Description

RNF111: Acts in the NODAL pathway of mesoderm patterning during embryonic development. Acts downstream AXIN1 as an E3 ubiquitin- protein ligase which promotes the ubiquitination of inhibitory SMADs such as SMAD7, induces their proteasomal degradation and thereby enhances the transcriptional activity of TGF-beta and BMP. Activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin ligase; Ubiquitin conjugating system; EC 6.3.2.-; Ligase

Chromosomal Location of Human Ortholog: 15q21

Cellular Component: nucleoplasm; protein complex; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; zinc ion binding; SUMO polymer binding; SMAD binding; ligase activity

Biological Process: transcription initiation from RNA polymerase II promoter; protein polyubiquitination; transcription, DNA-dependent; positive regulation of protein ubiquitination; positive regulation of transcription, DNA-dependent; transforming growth factor beta receptor signaling pathway; positive regulation of transforming growth factor beta receptor signaling pathway; protein ubiquitination; positive regulation of transcription from RNA polymerase II promoter; gene expression; ubiquitin-dependent SMAD protein catabolic process; pattern specification process

Research Articles on RNF111

Similar Products

Product Notes

The RNF111 rnf111 (Catalog #AAA6144056) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RING Finger Protein 111 (RNF111, E3 Ubiquitin-protein Ligase Arkadia, ARK) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RING Finger Protein 111 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF111 rnf111 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RING Finger Protein 111, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.