Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GMNN expression in transfected 293T cell line by GMNN monoclonal antibody. Lane 1: GMNN transfected lysate (23.6kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human Geminin Monoclonal Antibody | anti-GMNN antibody

Geminin (GMNN, GEM, Geminin DNA Replication Inhibitor, DNA Replication Inhibitor, RP3-369A17.3) (Biotin)

Gene Names
GMNN; Gem; MGORS6
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Geminin; Monoclonal Antibody; Geminin (GMNN; GEM; Geminin DNA Replication Inhibitor; DNA Replication Inhibitor; RP3-369A17.3) (Biotin); anti-GMNN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A8
Specificity
Recognizes human GMNN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GMNN antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa110-209 from human GMNN (AAH05185) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GMNN expression in transfected 293T cell line by GMNN monoclonal antibody. Lane 1: GMNN transfected lysate (23.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GMNN expression in transfected 293T cell line by GMNN monoclonal antibody. Lane 1: GMNN transfected lysate (23.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GMNN on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to GMNN on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GMNN is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GMNN is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)
Product Categories/Family for anti-GMNN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
23,565 Da
NCBI Official Full Name
Homo sapiens geminin, DNA replication inhibitor, mRNA
NCBI Official Synonym Full Names
geminin, DNA replication inhibitor
NCBI Official Symbol
GMNN
NCBI Official Synonym Symbols
Gem; MGORS6
NCBI Protein Information
geminin
Protein Family

NCBI Description

This gene encodes a protein that plays a critical role in cell cycle regulation. The encoded protein inhibits DNA replication by binding to DNA replication factor Cdt1, preventing the incorporation of minichromosome maintenance proteins into the pre-replication complex. The encoded protein is expressed during the S and G2 phases of the cell cycle and is degraded by the anaphase-promoting complex during the metaphase-anaphase transition. Increased expression of this gene may play a role in several malignancies including colon, rectal and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and two pseudogenes of this gene are located on the short arm of chromosome 16. [provided by RefSeq, Oct 2011]

Research Articles on GMNN

Similar Products

Product Notes

The GMNN (Catalog #AAA6142061) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Geminin (GMNN, GEM, Geminin DNA Replication Inhibitor, DNA Replication Inhibitor, RP3-369A17.3) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Geminin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GMNN for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Geminin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.