Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse GDF7 Monoclonal Antibody | anti-GDF7 antibody

GDF7 (Growth Differentiation Factor 7, BMP12) (MaxLight 550)

Gene Names
GDF7; BMP12
Applications
FLISA
Purity
Purified
Synonyms
GDF7; Monoclonal Antibody; GDF7 (Growth Differentiation Factor 7; BMP12) (MaxLight 550); Growth Differentiation Factor 7; BMP12; anti-GDF7 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A1
Specificity
Recognizes GDF7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
450
Applicable Applications for anti-GDF7 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GDF7 (NP_878248, 361aa-450aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GDF7 antibody
This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord. [provided by RefSeq]
Product Categories/Family for anti-GDF7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
growth/differentiation factor 7 preproprotein
NCBI Official Synonym Full Names
growth differentiation factor 7
NCBI Official Symbol
GDF7
NCBI Official Synonym Symbols
BMP12
NCBI Protein Information
growth/differentiation factor 7
UniProt Protein Name
Growth/differentiation factor 7
UniProt Gene Name
GDF7
UniProt Synonym Gene Names
GDF-7
UniProt Entry Name
GDF7_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein may play a role in the differentiation of tendon cells and spinal cord interneurons. A mutation in this gene may be associated with increased risk for Barrett's esophagus and esophageal adenocarcinoma. [provided by RefSeq, Sep 2016]

Uniprot Description

GDF7: May play an active role in the motor area of the primate neocortex. Belongs to the TGF-beta family.

Protein type: Cytokine; Secreted, signal peptide; Cell development/differentiation; Secreted

Chromosomal Location of Human Ortholog: 2p24.1

Cellular Component: extracellular space

Molecular Function: protein binding; protein homodimerization activity; growth factor activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: axon guidance; cell fate commitment; positive regulation of transcription, DNA-dependent; activin receptor signaling pathway; roof plate formation; forebrain morphogenesis; BMP signaling pathway; regulation of apoptosis; epithelial cell differentiation; branching morphogenesis of a tube; regulation of MAPKKK cascade; midbrain development; spinal cord association neuron differentiation; gland morphogenesis; positive regulation of neuron differentiation; cell development; reproductive structure development; growth

Research Articles on GDF7

Similar Products

Product Notes

The GDF7 gdf7 (Catalog #AAA6217074) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GDF7 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GDF7 gdf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GDF7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.