Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged GATA4 is 0.03 ng/ml as a capture antibody.)

Mouse GATA4 Monoclonal Antibody | anti-GATA4 antibody

GATA4 (GATA Binding Protein 4, MGC126629) (HRP)

Gene Names
GATA4; ASD2; VSD1
Applications
Western Blot
Purity
Purified
Synonyms
GATA4; Monoclonal Antibody; GATA4 (GATA Binding Protein 4; MGC126629) (HRP); GATA Binding Protein 4; MGC126629; anti-GATA4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6C6
Specificity
Recognizes GATA4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-GATA4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GATA4 (NP_002043.2, 343aa-442aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GATA4 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GATA4 is 0.03 ng/ml as a capture antibody.)
Product Categories/Family for anti-GATA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,565 Da
NCBI Official Full Name
transcription factor GATA-4
NCBI Official Synonym Full Names
GATA binding protein 4
NCBI Official Symbol
GATA4
NCBI Official Synonym Symbols
ASD2; VSD1
NCBI Protein Information
transcription factor GATA-4; GATA-binding factor 4
UniProt Protein Name
Transcription factor GATA-4
Protein Family
UniProt Gene Name
GATA4
UniProt Entry Name
GATA4_HUMAN

NCBI Description

This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects. [provided by RefSeq, Jul 2008]

Uniprot Description

GATA4: a conserved and ubiquitous member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. May regulate a set of cardiac-specific genes and play a crucial role in cardiogenesis. Defects are a cause of atrial septal defect 2 (ASD2). ASD2 is an autosomal dominant condition with atrial septal defect and other congenital heart disease but no conduction defects or noncardiac abnormalities.

Protein type: Transcription factor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8p23.1-p22

Cellular Component: nucleoplasm; nuclear chromatin; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; NFAT protein binding; transcription activator binding; DNA binding; zinc ion binding; sequence-specific DNA binding; transcription coactivator activity; chromatin binding; transcription factor binding; transcription factor activity

Biological Process: cardiac muscle hypertrophy; transcription from RNA polymerase II promoter; negative regulation of autophagy; positive regulation of transcription, DNA-dependent; embryonic heart tube anterior/posterior pattern formation; Sertoli cell differentiation; Wnt receptor signaling pathway through beta-catenin; BMP signaling pathway; regulation of transcription, DNA-dependent; cell-cell signaling; embryonic digestive tract morphogenesis; embryonic foregut morphogenesis; heart looping; positive regulation of BMP signaling pathway; positive regulation of cardiac muscle cell proliferation; response to drug; response to retinoic acid; in utero embryonic development; male gonad development; gastrulation with mouth forming second; positive regulation of angiogenesis; response to estrogen stimulus; response to mechanical stimulus; endoderm formation; positive regulation of cardioblast differentiation; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis; blood coagulation; endoderm development

Disease: Ventricular Septal Defect 1; Tetralogy Of Fallot; Atrial Septal Defect 2; Atrioventricular Septal Defect 4; Testicular Anomalies With Or Without Congenital Heart Disease

Research Articles on GATA4

Similar Products

Product Notes

The GATA4 gata4 (Catalog #AAA6183467) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GATA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GATA4 gata4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GATA4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.