Mouse GATA4 Monoclonal Antibody | anti-GATA4 antibody

GATA4 (GATA Binding Protein 4, MGC126629) (FITC)

Cat. Num. AAA6179057

• Gene Names: GATA4; ASD2; VSD1
• Applications: Western Blot
• Purity: Purified
• Synonyms: GATA4; Monoclonal Antibody; GATA4 (GATA Binding Protein 4; MGC126629) (FITC); GATA Binding Protein 4; MGC126629; anti-GATA4 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6C6
• Specificity: Recognizes GATA4.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-GATA4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GATA4 (NP_002043.2, 343aa-442aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GATA4 is 0.03 ng/ml as a capture antibody.)

Related Product Information for anti-GATA4 antibody

This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects. [provided by RefSeq]

Product Categories/Family for anti-GATA4 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 33188461
• NCBI GeneID: 2626
• NCBI Accession #: NP_002043.2
• NCBI GenBank Nucleotide #: NM_002052.3
• UniProt Accession #: P43694; Q3MJ45; Q5IFM8; B7ZKX0
• Molecular Weight: 44,565 Da
• NCBI Official Full Name: transcription factor GATA-4
• NCBI Official Synonym Full Names: GATA binding protein 4
• NCBI Official Symbol: GATA4
• NCBI Official Synonym Symbols: ASD2; VSD1
• NCBI Protein Information: transcription factor GATA-4; GATA-binding factor 4
• UniProt Protein Name: Transcription factor GATA-4
• Protein Family: GATA transcription factor
• UniProt Gene Name: GATA4
• UniProt Entry Name: GATA4_HUMAN

NCBI Description

This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects. [provided by RefSeq, Jul 2008]

Uniprot Description

GATA4: a conserved and ubiquitous member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. May regulate a set of cardiac-specific genes and play a crucial role in cardiogenesis. Defects are a cause of atrial septal defect 2 (ASD2). ASD2 is an autosomal dominant condition with atrial septal defect and other congenital heart disease but no conduction defects or noncardiac abnormalities.

Protein type: Transcription factor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8p23.1-p22

Cellular Component: nucleoplasm; nuclear chromatin; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; NFAT protein binding; transcription activator binding; DNA binding; zinc ion binding; sequence-specific DNA binding; transcription coactivator activity; chromatin binding; transcription factor binding; transcription factor activity

Biological Process: cardiac muscle hypertrophy; transcription from RNA polymerase II promoter; negative regulation of autophagy; positive regulation of transcription, DNA-dependent; embryonic heart tube anterior/posterior pattern formation; Sertoli cell differentiation; Wnt receptor signaling pathway through beta-catenin; BMP signaling pathway; regulation of transcription, DNA-dependent; cell-cell signaling; embryonic digestive tract morphogenesis; embryonic foregut morphogenesis; heart looping; positive regulation of BMP signaling pathway; positive regulation of cardiac muscle cell proliferation; response to drug; response to retinoic acid; in utero embryonic development; male gonad development; gastrulation with mouth forming second; positive regulation of angiogenesis; response to estrogen stimulus; response to mechanical stimulus; endoderm formation; positive regulation of cardioblast differentiation; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis; blood coagulation; endoderm development

Disease: Ventricular Septal Defect 1; Tetralogy Of Fallot; Atrial Septal Defect 2; Atrioventricular Septal Defect 4; Testicular Anomalies With Or Without Congenital Heart Disease