Western Blot (WB)
(WB Suggested Anti-KCNG4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Rabbit anti-Human KCNG4 Polyclonal Antibody | anti-KCNG4 antibody
KCNG4 antibody - N-terminal region
Gene Names
KCNG4; KV6.3; KV6.4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNG4; Polyclonal Antibody; KCNG4 antibody - N-terminal region; anti-KCNG4 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP
Sequence Length
519
Applicable Applications for anti-KCNG4 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNG4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-KCNG4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Western Blot (WB)
(WB Suggested Anti-KCNG4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Related Product Information for anti-KCNG4 antibody
This is a rabbit polyclonal antibody against KCNG4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG4 is a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The protein has strong expression in brain.Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The gene has strong expression in brain. Multiple alternatively spliced variants have been found in normal and cancerous tissues.
Target Description: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG4 is a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The protein has strong expression in brain.Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The gene has strong expression in brain. Multiple alternatively spliced variants have been found in normal and cancerous tissues.
Product Categories/Family for anti-KCNG4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily G member 4
NCBI Official Synonym Full Names
potassium voltage-gated channel modifier subfamily G member 4
NCBI Official Symbol
KCNG4
NCBI Official Synonym Symbols
KV6.3; KV6.4
NCBI Protein Information
potassium voltage-gated channel subfamily G member 4
UniProt Protein Name
Potassium voltage-gated channel subfamily G member 4
Protein Family
UniProt Gene Name
KCNG4
UniProt Synonym Gene Names
KCNG3
UniProt Entry Name
KCNG4_HUMAN
NCBI Description
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The gene has strong expression in brain. Multiple alternatively spliced variants have been found in normal and cancerous tissues. [provided by RefSeq, Jul 2008]
Research Articles on KCNG4
Similar Products
Product Notes
The KCNG4 kcng4 (Catalog #AAA3202601) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNG4 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCNG4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNG4 kcng4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QEELAYWGIE EAHLERCCLR KLLRKLEELE ELAKLHREDV LRQQRETRRP. It is sometimes possible for the material contained within the vial of "KCNG4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
