Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (51.92kD).)

Mouse anti-Human GAP43 Monoclonal Antibody | anti-GAP43 antibody

GAP43 (Neuromodulin, Axonal Membrane Protein GAP-43, Growth-associated Protein 43, Neural Phosphoprotein B-50, pp46) (Biotin)

Gene Names
GAP43; B-50; PP46
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GAP43; Monoclonal Antibody; GAP43 (Neuromodulin; Axonal Membrane Protein GAP-43; Growth-associated Protein 43; Neural Phosphoprotein B-50; pp46) (Biotin); anti-GAP43 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C11
Specificity
Recognizes human GAP43.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GAP43 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-238 from human GAP43 (AAH07936) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (51.92kD).)

Western Blot (WB) (Western Blot detection against Immunogen (51.92kD).)

Western Blot (WB)

(Western Blot analysis of GAP43 expression in transfected 293T cell line by GAP43 monoclonal antibody. Lane 1: GAP43 transfected lysate (24.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GAP43 expression in transfected 293T cell line by GAP43 monoclonal antibody. Lane 1: GAP43 transfected lysate (24.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged GAP43 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GAP43 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-GAP43 antibody
GAP43 is expressed by developing and regenerating neurons, and to a lesser extent, reactive glial cells.It is used widely to specifically label injured neurons and to score neuronal regeneration. GAP43 is also a neuronal growth cone protein thought to be involved in pathfinding. GAP43 is considered to be a crucial component of an effective regenerative response in the nervous system.
Product Categories/Family for anti-GAP43 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
28,766 Da
NCBI Official Full Name
Homo sapiens growth associated protein 43, mRNA
NCBI Official Synonym Full Names
growth associated protein 43
NCBI Official Symbol
GAP43
NCBI Official Synonym Symbols
B-50; PP46
NCBI Protein Information
neuromodulin
Protein Family

NCBI Description

The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on GAP43

Similar Products

Product Notes

The GAP43 (Catalog #AAA6142024) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GAP43 (Neuromodulin, Axonal Membrane Protein GAP-43, Growth-associated Protein 43, Neural Phosphoprotein B-50, pp46) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GAP43 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GAP43 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GAP43, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.