Mouse anti-Human GADD45A Monoclonal Antibody | anti-GADD45A antibody

GADD45A (Growth Arrest And DNA-damage-inducible Protein GADD45 alpha, DNA-damage-inducible Transcript 1, DDIT-1, DDIT1, GADD45) (HRP)

Cat. Num. AAA6152614

• Gene Names: GADD45A; DDIT1; GADD45
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GADD45A; Monoclonal Antibody; GADD45A (Growth Arrest And DNA-damage-inducible Protein GADD45 alpha; DNA-damage-inducible Transcript 1; DDIT-1; DDIT1; GADD45) (HRP); anti-GADD45A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3D12
• Specificity: Recognizes human GADD45A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-GADD45A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody.; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa76-165 from human GADD45A (AAH11757) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAP2K6 and GADD45A HeLa cells were stained with MAP2K6 rabbit purified polyclonal 1:1200 and GADD45A mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Product Categories/Family for anti-GADD45A antibody

Antibodies; Apoptosis

References

1. Inhibition of NF-kB activation sensitizes U937 cells to 3-azido-3-deoxythymidine induced apoptosis. Matteucci C, Minutolo A, Balestrieri E, Marino-Merlo F, Bramanti P, Garaci E, Macchi B, Mastino A.Cell Death and Disease (2010) 1, e81; doi:10.1038/ cddis.2010.58. 2.Decitabine-Induced Demethylation of 5'CpG Island in GADD45A Leads to Apoptosis in Osteosarcoma Cells. Al-Romaih K, Sadikovic B, Yoshimoto M, Wang Y, Zielenska M, Squire JA.Neoplasia. 2008 May;10(5):471-80.

NCBI and Uniprot Product Information

• NCBI GI #: 33877671
• NCBI GeneID: 1647
• Molecular Weight: 14,622 Da
• NCBI Official Full Name: Homo sapiens growth arrest and DNA-damage-inducible, alpha, mRNA
• NCBI Official Synonym Full Names: growth arrest and DNA damage inducible alpha
• NCBI Official Symbol: GADD45A
• NCBI Official Synonym Symbols: DDIT1; GADD45
• NCBI Protein Information: growth arrest and DNA damage-inducible protein GADD45 alpha
• Protein Family: Growth arrest and DNA damage-inducible protein

NCBI Description

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Dec 2010]