Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Mouse anti-Human GADD153 Monoclonal Antibody | anti-GADD153 antibody

GADD153 (DNA Damage-inducible Transcript 3 Protein, DDIT-3, C/EBP-homologous Protein, CHOP, C/EBP-homologous Protein 10, CHOP-10, Growth Arrest and DNA Damage-inducible Protein GADD153, DDIT3, CHOP, CHOP10) (Biotin)

Gene Names
DDIT3; CHOP; CEBPZ; CHOP10; CHOP-10; GADD153
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GADD153; Monoclonal Antibody; GADD153 (DNA Damage-inducible Transcript 3 Protein; DDIT-3; C/EBP-homologous Protein; CHOP; C/EBP-homologous Protein 10; CHOP-10; Growth Arrest and DNA Damage-inducible Protein GADD153; DDIT3; CHOP10) (Biotin); anti-GADD153 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G3
Specificity
Recognizes human DDIT3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GADD153 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from human DDIT3 (AAH03637) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Testing Data

(Detection limit for recombinant GST tagged DDIT3 is ~0.03ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged DDIT3 is ~0.03ng/ml as a capture antibody)
Product Categories/Family for anti-GADD153 antibody
References
1. Loss of UDP-N-acetylglucosamine 2-epimerase/ N-acetylmannosamine kinase (GNE) induces apoptotic processes in pancreatic carcinoma cells. Kemmner W, Kessel P, Sanchez-Ruderisch H, Moller H, Hinderlich S, Schlag PM, Detjen K.FASEB J. 2011 Nov 2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
21,700 Da
NCBI Official Full Name
Homo sapiens DNA-damage-inducible transcript 3, mRNA
NCBI Official Synonym Full Names
DNA damage inducible transcript 3
NCBI Official Symbol
DDIT3
NCBI Official Synonym Symbols
CHOP; CEBPZ; CHOP10; CHOP-10; GADD153
NCBI Protein Information
DNA damage-inducible transcript 3 protein

NCBI Description

This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified. [provided by RefSeq, Aug 2010]

Research Articles on GADD153

Similar Products

Product Notes

The GADD153 (Catalog #AAA6142007) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GADD153 (DNA Damage-inducible Transcript 3 Protein, DDIT-3, C/EBP-homologous Protein, CHOP, C/EBP-homologous Protein 10, CHOP-10, Growth Arrest and DNA Damage-inducible Protein GADD153, DDIT3, CHOP, CHOP10) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GADD153 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GADD153 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GADD153, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.