Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Mouse anti-Human FUNDC2 Monoclonal Antibody | anti-FUNDC2 antibody
FUNDC2 (HCBP6, FUN14 Domain-containing Protein 2, Cervical Cancer Proto-oncogene 3 Protein, HCC-3, Hepatitis C Virus Core-binding Protein 6, DC44, FLJ33773, HCC3, MGC131676, MGC2495, PD03104)
Gene Names
FUNDC2; HCBP6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
FUNDC2; Monoclonal Antibody; FUNDC2 (HCBP6; FUN14 Domain-containing Protein 2; Cervical Cancer Proto-oncogene 3 Protein; HCC-3; Hepatitis C Virus Core-binding Protein 6; DC44; FLJ33773; HCC3; MGC131676; MGC2495; PD03104); Anti -FUNDC2 (HCBP6; anti-FUNDC2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G12
Specificity
Recognizes human FUNDC2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLFGQESGPSAEKYSVATQLFIGGVTGWCTGFI
Applicable Applications for anti-FUNDC2 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Recombinant protein corresponding to aa1-100 from human FUNDC2 (NP_076423) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(FUNDC2 monoclonal antibody. Western Blot analysis of FUNDC2 expression in human kidney.)
Western Blot (WB)
(FUNDC2 monoclonal antibody. Western Blot analysis of FUNDC2 expression in human kidney.)
Product Categories/Family for anti-FUNDC2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,577 Da
NCBI Official Full Name
FUN14 domain-containing protein 2
NCBI Official Synonym Full Names
FUN14 domain containing 2
NCBI Official Symbol
FUNDC2
NCBI Official Synonym Symbols
HCBP6
NCBI Protein Information
FUN14 domain-containing protein 2; hepatitis C virus core-binding protein 6
UniProt Protein Name
FUN14 domain-containing protein 2
Protein Family
UniProt Gene Name
FUNDC2
UniProt Synonym Gene Names
HCBP6
UniProt Entry Name
FUND2_BOVIN
Uniprot Description
Sequence similarities: Belongs to the FUN14 family.
Similar Products
Product Notes
The FUNDC2 fundc2 (Catalog #AAA649775) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FUNDC2 (HCBP6, FUN14 Domain-containing Protein 2, Cervical Cancer Proto-oncogene 3 Protein, HCC-3, Hepatitis C Virus Core-binding Protein 6, DC44, FLJ33773, HCC3, MGC131676, MGC2495, PD03104) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FUNDC2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the FUNDC2 fundc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: METSAPRAGS QVVATTARHS AAYRADPLRV SSRDKLTEMA ASSQGNFEGN FESLDLAEFA KKQPWWRKLF GQESGPSAEK YSVATQLFIG GVTGWCTGFI. It is sometimes possible for the material contained within the vial of "FUNDC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
