Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human FUCA2 Monoclonal Antibody | anti-FUCA2 antibody

FUCA2 (Fucosidase alpha-L- 2 Plasma, Alpha-L-fucoside Fucohydrolase 2, Alpha-L-fucosidase 2, dJ20N2.5, MGC1314, Plasma alpha-L-fucosidase, PSEC0151, RP1-20N2.5, UNQ227/PRO260) (AP)

Gene Names
FUCA2; dJ20N2.5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FUCA2; Monoclonal Antibody; FUCA2 (Fucosidase alpha-L- 2 Plasma; Alpha-L-fucoside Fucohydrolase 2; Alpha-L-fucosidase 2; dJ20N2.5; MGC1314; Plasma alpha-L-fucosidase; PSEC0151; RP1-20N2.5; UNQ227/PRO260) (AP); anti-FUCA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D2
Specificity
Recognizes human FUCA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-FUCA2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa368-466 from human FUCA2 (NP_114409) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YETHTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAILGATEVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged FUCA2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FUCA2 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-FUCA2 antibody
Alpha-L-fucosidase catalyzes the hydrolysis of terminal alpha-L-fucosidase linkages in glycosphingolipids and glycoproteins. At least 2 separate polymorphic alpha-L-fucosidases are recognized in man. The FUCA2 locus regulates the level of alpha-fucosidase in plasma and fibroblasts but not in leukocytes. In fucosidosis, deficiency of alpha-L-fucosidase is found in both plasma and leukocytes.
Product Categories/Family for anti-FUCA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53.3 kDa (462aa)
NCBI Official Full Name
plasma alpha-L-fucosidase
NCBI Official Synonym Full Names
alpha-L-fucosidase 2
NCBI Official Symbol
FUCA2
NCBI Official Synonym Symbols
dJ20N2.5
NCBI Protein Information
plasma alpha-L-fucosidase
UniProt Protein Name
Plasma alpha-L-fucosidase
Protein Family
UniProt Gene Name
FUCA2
UniProt Synonym Gene Names
Alpha-L-fucosidase 2
UniProt Entry Name
FUCO2_HUMAN

NCBI Description

This gene encodes a plasma alpha-L-fucosidase, which represents 10-20% of the total cellular fucosidase activity. The protein is a member of the glycosyl hydrolase 29 family, and catalyzes the hydrolysis of the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. This enzyme is essential for Helicobacter pylori adhesion to human gastric cancer cells. [provided by RefSeq, Aug 2010]

Uniprot Description

FUCA2: Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N- acetylglucosamine of the carbohydrate moieties of glycoproteins. Belongs to the glycosyl hydrolase 29 family.

Protein type: Secreted; EC 3.2.1.51; Glycan Metabolism - other glycan degradation; Hydrolase; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 6q24

Cellular Component: extracellular space; lysosome

Molecular Function: alpha-L-fucosidase activity; fucose binding

Biological Process: fucose metabolic process; glycoside catabolic process; response to bacterium

Research Articles on FUCA2

Similar Products

Product Notes

The FUCA2 fuca2 (Catalog #AAA6131371) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FUCA2 (Fucosidase alpha-L- 2 Plasma, Alpha-L-fucoside Fucohydrolase 2, Alpha-L-fucosidase 2, dJ20N2.5, MGC1314, Plasma alpha-L-fucosidase, PSEC0151, RP1-20N2.5, UNQ227/PRO260) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FUCA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FUCA2 fuca2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FUCA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.