Mouse FOXM1 Monoclonal Antibody | anti-FOXM1 antibody

FOXM1 (Forkhead Box M1, FKHL16, FOXM1B, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TGT3, TRIDENT) (AP)

Cat. Num. AAA6162547

• Gene Names: FOXM1; MPP2; HFH11; HNF-3; INS-1; MPP-2; PIG29; FKHL16; FOXM1A; FOXM1B; FOXM1C; HFH-11; TRIDENT; MPHOSPH2
• Applications: Western Blot
• Purity: Purified
• Synonyms: FOXM1; Monoclonal Antibody; FOXM1 (Forkhead Box M1; FKHL16; FOXM1B; HFH-11; HFH11; HNF-3; INS-1; MPHOSPH2; MPP-2; MPP2; PIG29; TGT3; TRIDENT) (AP); Forkhead Box M1; TRIDENT; anti-FOXM1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 200
• Specificity: Recognizes FOXM1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-FOXM1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: FOXM1 (NP_973731, 22aa-110aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILIS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FOXM1 is 0.3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXM1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXM1 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-FOXM1 antibody

Mouse monoclonal antibody raised against a full length recombinant FOXM1.

Product Categories/Family for anti-FOXM1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 42544167
• NCBI GeneID: 2305
• NCBI Accession #: NP_973731
• NCBI GenBank Nucleotide #: NM_202002
• UniProt Accession #: Q08050
• Molecular Weight: 88kDa
• NCBI Official Full Name: forkhead box protein M1 isoform 1
• NCBI Official Synonym Full Names: forkhead box M1
• NCBI Official Symbol: FOXM1
• NCBI Official Synonym Symbols: MPP2; HFH11; HNF-3; INS-1; MPP-2; PIG29; FKHL16; FOXM1A; FOXM1B; FOXM1C; HFH-11; TRIDENT; MPHOSPH2
• NCBI Protein Information: forkhead box protein M1
• UniProt Protein Name: Forkhead box protein M1
• Protein Family: Forkhead box protein
• UniProt Gene Name: FOXM1
• UniProt Synonym Gene Names: FKHL16; HFH11; MPP2; WIN; HFH-11; HNF-3/fork-head homolog 11
• UniProt Entry Name: FOXM1_HUMAN

NCBI Description

The protein encoded by this gene is a transcriptional activator involved in cell proliferation. The encoded protein is phosphorylated in M phase and regulates the expression of several cell cycle genes, such as cyclin B1 and cyclin D1. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]

Uniprot Description

FOXM1: a transcriptional activator factor. Contains 1 fork-head domain. May play a role in the control of cell proliferation. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Phosphorylated in M (mitotic) phase. Three splice variant isoforms have been described. Isoform 1 and isoform 2 appear to be the only activators of gene transcription. Isoform 3, found in rat, does not seem to exist in human.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein binding; DNA binding; sequence-specific DNA binding; transcription factor activity; protein kinase binding

Biological Process: transcription from RNA polymerase II promoter; regulation of Ras protein signal transduction; regulation of cell cycle; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; DNA repair; negative regulation of stress-activated MAPK cascade; liver development; cell cycle; regulation of cell proliferation; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; regulation of cell growth; negative regulation of transcription, DNA-dependent; G2/M transition of mitotic cell cycle; vasculogenesis