Western Blot (WB)
(Western Blot detection against Immunogen (67.54kD).)
Mouse anti-Human FOS Monoclonal Antibody | anti-FOS antibody
FOS (Proto-oncogene c-Fos, Cellular Oncogene Fos, G0/G1 Switch Regulatory Protein 7, G0S7) APC
Gene Names
FOS; p55; AP-1; C-FOS
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FOS; Monoclonal Antibody; FOS (Proto-oncogene c-Fos; Cellular Oncogene Fos; G0/G1 Switch Regulatory Protein 7; G0S7) APC; anti-FOS antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D11
Specificity
Recognizes human FOS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-FOS antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-380 from human FOS (AAH04490) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (67.54kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (67.54kD).)
Testing Data
(Detection limit for recombinant GST tagged FOS is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged FOS is 0.3ng/ml as a capture antibody.)
Testing Data
(Proximity Ligation Analysis (PLA) of protein-protein interactions between EGFR and FOS HeLa cells were stained with EGFR rabbit purified polyclonal 1:1200 and FOS mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Testing Data
(Proximity Ligation Analysis (PLA) of protein-protein interactions between EGFR and FOS HeLa cells were stained with EGFR rabbit purified polyclonal 1:1200 and FOS mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-FOS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
36,301 Da
NCBI Official Full Name
Homo sapiens v-fos FBJ murine osteosarcoma viral oncogene homolog, mRNA
NCBI Official Synonym Full Names
FBJ murine osteosarcoma viral oncogene homolog
NCBI Official Symbol
FOS
NCBI Official Synonym Symbols
p55; AP-1; C-FOS
NCBI Protein Information
proto-oncogene c-Fos; FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS); G0/G1 switch regulatory protein 7; activator protein 1; cellular oncogene c-fos
Protein Family
NCBI Description
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. [provided by RefSeq, Jul 2008]
Research Articles on FOS
Similar Products
Product Notes
The FOS (Catalog #AAA6136643) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FOS (Proto-oncogene c-Fos, Cellular Oncogene Fos, G0/G1 Switch Regulatory Protein 7, G0S7) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOS for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
