Western Blot (WB)
(Western Blot detection against Immunogen (45.69kD).)
Mouse anti-Human FMNL2 Monoclonal Antibody | anti-FMNL2 antibody
FMNL2 (Formin-like Protein 2, Formin Homology 2 Domain-containing Protein 2, FHOD2, FLJ37546, KIAA1902) (HRP)
Gene Names
FMNL2; FHOD2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FMNL2; Monoclonal Antibody; FMNL2 (Formin-like Protein 2; Formin Homology 2 Domain-containing Protein 2; FHOD2; FLJ37546; KIAA1902) (HRP); anti-FMNL2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Clone Number
2B4
Specificity
Recognizes human FMNL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-FMNL2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-179 from human FMNL2 (AAH36492) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIITALKKNNITKFPNVHSRVRISSSTPVVEDTQS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (45.69kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (45.69kD).)
Western Blot (WB)
(FMNL2 monoclonal antibody, Western Blot analysis of FMNL2 expression in IMR-32.)
Western Blot (WB)
(FMNL2 monoclonal antibody, Western Blot analysis of FMNL2 expression in IMR-32.)
Related Product Information for anti-FMNL2 antibody
Formin-like protein 2 is a cytoplasmic phosphoprotein belonging to the formin homology domain containing protein family and has a DAD (diaphanous autoregulatory domain), FH2 (formin homology 2) domain, and GBD/FH3 (Rho GTPase-binding/formin homology 3) domain. The exact function of FMNL2 is yet to be known but reports suggest that it may have a role in the Wnt signaling pathway. Formin-related proteins are also known to play an important role in morphogenesis, cytokinesis and cell polarity. Several alternatively spliced transcript variants have been described but their full-length nature is not yet determined. It is also known to be associated with a diffuse-type gastric cancer, breast cancer, chondrosarcoma, melanoma, and glioblastoma. FMNL2 might be implicated in polarity control, invasion, migration or metastasis through actin filament nucleation and may be regulated by Rho family GTPase.
Product Categories/Family for anti-FMNL2 antibody
NCBI and Uniprot Product Information
NCBI Description
This gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. Alternatively spliced transcript variants encoding different isoforms have been described but their full-length nature has yet to be determined. [provided by RefSeq, Jul 2008]
Research Articles on FMNL2
Similar Products
Product Notes
The FMNL2 (Catalog #AAA6152545) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FMNL2 (Formin-like Protein 2, Formin Homology 2 Domain-containing Protein 2, FHOD2, FLJ37546, KIAA1902) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FMNL2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FMNL2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FMNL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
