Testing Data
(Detection limit for recombinant GST tagged FMN2 is ~0.3ng/ml as a capture antibody.)
Mouse anti-Human FMN2 Monoclonal Antibody | anti-FMN2 antibody
FMN2 (Formin 2, Formin-2) APC
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FMN2; Monoclonal Antibody; FMN2 (Formin 2; Formin-2) APC; anti-FMN2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B8
Specificity
Recognizes human FMN2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1542
Applicable Applications for anti-FMN2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa144-243 from human FMN2 (AAH14364) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKENKLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged FMN2 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged FMN2 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-FMN2 antibody
FMN2, a novel formin homology protein of the cappuccino subfamily, is highly conserved between evolutionarily diverse vertebrates. FMN2 bears a high degree of similarity to formin-1 which is the founding member of formin homology proteins. FMN2 plays a crucial role in maintenance of the meiotic spindle. The protein is widely expressed in human fetal brain, adult whole brain, hypothalamus, retina, pancreatic islet and germinal-center B cells. Pathological role of the protein is identified in various tumors like parathyloid tumor, glioblastoma, retinoblastoma and chondrosarcoma. FMN2 mutations are often a cause of unexplained infertility in women. The gene encoding for human FMN2 is localized in the chromosomal region 1q43.
Product Categories/Family for anti-FMN2 antibody
NCBI and Uniprot Product Information
NCBI Description
This gene is a member of the formin homology protein family. The encoded protein is thought to have essential roles in organization of the actin cytoskeleton and in cell polarity. This protein mediates the formation of an actin mesh that positions the spindle during oogenesis and also regulates the formation of actin filaments in the nucleus. This protein also forms a perinuclear actin/focal-adhesion system that regulates the shape and position of the nucleus during cell migration. Mutations in this gene have been associated with infertility and also with an autosomal recessive form of intellectual disability (MRT47). Alternatively spliced transcript variants have been identified. [provided by RefSeq, Jul 2017]
Research Articles on FMN2
Similar Products
Product Notes
The FMN2 (Catalog #AAA6136634) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FMN2 (Formin 2, Formin-2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FMN2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FMN2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FMN2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
