Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (76.01kD).)

Mouse anti-Human FKBP5 Monoclonal Antibody | anti-FKBP5 antibody

FKBP5 (FK506-binding Protein 5, Peptidyl-prolyl cis-trans Isomerase FKBP5, PPIase FKBP5, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 51kD FK506-binding Protein, 51kD FKBP, FKBP-51, 54kD Progesterone Receptor-associated Immunophilin, FKBP54, p

Gene Names
FKBP5; P54; AIG6; FKBP51; FKBP54; PPIase; Ptg-10
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FKBP5; Monoclonal Antibody; FKBP5 (FK506-binding Protein 5; Peptidyl-prolyl cis-trans Isomerase FKBP5; PPIase FKBP5; Rotamase; HSP-binding Immunophilin; HBI; FKBP52 Protein; 51kD FK506-binding Protein; 51kD FKBP; FKBP-51; 54kD Progesterone Receptor-associated Immunophilin; FKBP54; p; anti-FKBP5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3D1-1B10
Specificity
Recognizes human FKBP5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
3888
Applicable Applications for anti-FKBP5 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-457 from human FKBP5 (AAH42605) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (76.01kD).)

Western Blot (WB) (Western Blot detection against Immunogen (76.01kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FKBP5 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FKBP5 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged FKBP5 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FKBP5 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-FKBP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens FK506 binding protein 5, mRNA
NCBI Official Synonym Full Names
FKBP prolyl isomerase 5
NCBI Official Symbol
FKBP5
NCBI Official Synonym Symbols
P54; AIG6; FKBP51; FKBP54; PPIase; Ptg-10
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP5
Protein Family

NCBI Description

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]

Research Articles on FKBP5

Similar Products

Product Notes

The FKBP5 (Catalog #AAA6141917) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FKBP5 (FK506-binding Protein 5, Peptidyl-prolyl cis-trans Isomerase FKBP5, PPIase FKBP5, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 51kD FK506-binding Protein, 51kD FKBP, FKBP-51, 54kD Progesterone Receptor-associated Immunophilin, FKBP54, p reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FKBP5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FKBP5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.