Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FIS1 monoclonal antibody (M02), clone 3G6. Western Blot analysis of FIS1 expression in MCF-7 (Cat # L046V1).)

Mouse FIS1 Monoclonal Antibody | anti-FIS1 antibody

FIS1 (Fission 1 (Mitochondrial outer Membrane) Homolog (S. cerevisiae), CGI-135, TTC11) (Biotin)

Gene Names
FIS1; TTC11; CGI-135
Applications
Western Blot
Purity
Purified
Synonyms
FIS1; Monoclonal Antibody; FIS1 (Fission 1 (Mitochondrial outer Membrane) Homolog (S. cerevisiae); CGI-135; TTC11) (Biotin); Fission 1 (Mitochondrial outer Membrane) Homolog (S. cerevisiae); TTC11; anti-FIS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G6
Specificity
Recognizes FIS1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
152
Applicable Applications for anti-FIS1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FIS1 (AAH03540.1, 1aa-152aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FIS1 monoclonal antibody (M02), clone 3G6. Western Blot analysis of FIS1 expression in MCF-7 (Cat # L046V1).)

Western Blot (WB) (FIS1 monoclonal antibody (M02), clone 3G6. Western Blot analysis of FIS1 expression in MCF-7 (Cat # L046V1).)

Testing Data

(Detection limit for recombinant GST tagged FIS1 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FIS1 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-FIS1 antibody
The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]). [supplied by OMIM]
Product Categories/Family for anti-FIS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
NCBI Official Synonym Full Names
fission, mitochondrial 1
NCBI Official Symbol
FIS1
NCBI Official Synonym Symbols
TTC11; CGI-135
NCBI Protein Information
mitochondrial fission 1 protein

NCBI Description

The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008]

Research Articles on FIS1

Similar Products

Product Notes

The FIS1 (Catalog #AAA6172645) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FIS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FIS1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FIS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.