Mouse anti-Human Filensin Monoclonal Antibody | anti-BFSP1 antibody

Filensin (Beaded Filament Structural Protein 1, BFSP1, Lens Fiber Cell Beaded-filament Structural Protein CP 115, CP115, Lens Intermediate Filament-like Heavy, LIFL-H) (Biotin)

Cat. Num. AAA6141912

• Gene Names: BFSP1; CP94; CP115; LIFL-H; CTRCT33
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Filensin; Monoclonal Antibody; Filensin (Beaded Filament Structural Protein 1; BFSP1; Lens Fiber Cell Beaded-filament Structural Protein CP 115; CP115; Lens Intermediate Filament-like Heavy; LIFL-H) (Biotin); anti-BFSP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6B4
• Specificity: Recognizes human BFSP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-BFSP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa567-664 from human BFSP1 (NP_001186) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEVLGTRSRSLPEKGPPKALAYKTVEVVESIEKISTESIQTYEETAVIVETMIGKTKSDKKKSGEKS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(BFSP1 monoclonal antibody, Western Blot analysis of BFSP1 expression in HL-60.)

Testing Data

(Detection limit for recombinant GST tagged BFSP1 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-BFSP1 antibody

Filensin, also known as beaded filament structure protein 1, have two major component BFSP1 and BESP2. Filensin gene is mapped at 20p12.1-p11.23. The sequence of the predicted 665aa human protein is 62% and 50% identical to those of bovine and chicken filensin, respectively. However,it has less than 26% identity to other members of the intermediate filament (IF) family.

Product Categories/Family for anti-BFSP1 antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 4502399
• NCBI GeneID: 631
• NCBI Accession #: NP_001186
• NCBI GenBank Nucleotide #: NM_001195
• UniProt Accession #: Q12934
• Molecular Weight: 74kDa
• NCBI Official Full Name: filensin isoform 1
• NCBI Official Synonym Full Names: beaded filament structural protein 1
• NCBI Official Symbol: BFSP1
• NCBI Official Synonym Symbols: CP94; CP115; LIFL-H; CTRCT33
• NCBI Protein Information: filensin
• UniProt Protein Name: Filensin
• Protein Family: Filensin
• UniProt Gene Name: BFSP1
• UniProt Synonym Gene Names: CP115; LIFL-H
• UniProt Entry Name: BFSP1_HUMAN

NCBI Description

This gene encodes a lens-specific intermediate filament-like protein named filensin. The encoded protein is expressed in lens fiber cells after differentiation has begun. This protein functions as a component of the beaded filament which is a cytoskeletal structure found in lens fiber cells. Mutations in this gene are the cause of autosomal recessive cortical juvenile-onset cataract. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

BFSP1: Defects in BFSP1 are the cause of cataract cortical juvenile-onset (CCJO). A juvenile-onset cataract with opacities restricted to the cortex of the lens, not involving the nucleus. Belongs to the intermediate filament family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 20p12.1

Cellular Component: mitochondrion; cytoplasm; plasma membrane; intermediate filament; actin cytoskeleton

Molecular Function: structural constituent of cytoskeleton; structural constituent of eye lens

Biological Process: cell maturation

Disease: Cataract 33