Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human Filensin Monoclonal Antibody | anti-BFSP1 antibody

Filensin (Beaded Filament Structural Protein 1, BFSP1, Lens Fiber Cell Beaded-filament Structural Protein CP 115, CP115, Lens Intermediate Filament-like Heavy, LIFL-H) (AP)

Gene Names
BFSP1; CP94; CP115; LIFL-H; CTRCT33
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Filensin; Monoclonal Antibody; Filensin (Beaded Filament Structural Protein 1; BFSP1; Lens Fiber Cell Beaded-filament Structural Protein CP 115; CP115; Lens Intermediate Filament-like Heavy; LIFL-H) (AP); anti-BFSP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6B4
Specificity
Recognizes human BFSP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-BFSP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa567-664 from human BFSP1 (NP_001186) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEVLGTRSRSLPEKGPPKALAYKTVEVVESIEKISTESIQTYEETAVIVETMIGKTKSDKKKSGEKS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(BFSP1 monoclonal antibody, Western Blot analysis of BFSP1 expression in HL-60.)

Western Blot (WB) (BFSP1 monoclonal antibody, Western Blot analysis of BFSP1 expression in HL-60.)

Testing Data

(Detection limit for recombinant GST tagged BFSP1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BFSP1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-BFSP1 antibody
Filensin, also known as beaded filament structure protein 1, have two major component BFSP1 and BESP2. Filensin gene is mapped at 20p12.1-p11.23. The sequence of the predicted 665aa human protein is 62% and 50% identical to those of bovine and chicken filensin, respectively. However,it has less than 26% identity to other members of the intermediate filament (IF) family.
Product Categories/Family for anti-BFSP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
631
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
filensin isoform 1
NCBI Official Synonym Full Names
beaded filament structural protein 1
NCBI Official Symbol
BFSP1
NCBI Official Synonym Symbols
CP94; CP115; LIFL-H; CTRCT33
NCBI Protein Information
filensin
UniProt Protein Name
Filensin
Protein Family
UniProt Gene Name
BFSP1
UniProt Synonym Gene Names
CP115; LIFL-H
UniProt Entry Name
BFSP1_HUMAN

NCBI Description

This gene encodes a lens-specific intermediate filament-like protein named filensin. The encoded protein is expressed in lens fiber cells after differentiation has begun. This protein functions as a component of the beaded filament which is a cytoskeletal structure found in lens fiber cells. Mutations in this gene are the cause of autosomal recessive cortical juvenile-onset cataract. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

BFSP1: Defects in BFSP1 are the cause of cataract cortical juvenile-onset (CCJO). A juvenile-onset cataract with opacities restricted to the cortex of the lens, not involving the nucleus. Belongs to the intermediate filament family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 20p12.1

Cellular Component: mitochondrion; cytoplasm; plasma membrane; intermediate filament; actin cytoskeleton

Molecular Function: structural constituent of cytoskeleton; structural constituent of eye lens

Biological Process: cell maturation

Disease: Cataract 33

Research Articles on BFSP1

Similar Products

Product Notes

The BFSP1 bfsp1 (Catalog #AAA6131306) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Filensin (Beaded Filament Structural Protein 1, BFSP1, Lens Fiber Cell Beaded-filament Structural Protein CP 115, CP115, Lens Intermediate Filament-like Heavy, LIFL-H) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Filensin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BFSP1 bfsp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Filensin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.