Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (56.98kD).)

Mouse anti-Human FHL5 Monoclonal Antibody | anti-FHL5 antibody

FHL5 (Four and a Half LIM Domains Protein 5, FHL-5, Activator of cAMP-responsive Element Modulator in Testis, Activator of CREM in Testis, ACT, dJ393D12.2, FLJ33049, KIAA0776, RP3-393D12.2) (Biotin)

Gene Names
FHL5; ACT; FHL-5; dJ393D12.2; 1700027G07Rik
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FHL5; Monoclonal Antibody; FHL5 (Four and a Half LIM Domains Protein 5; FHL-5; Activator of cAMP-responsive Element Modulator in Testis; Activator of CREM in Testis; ACT; dJ393D12.2; FLJ33049; KIAA0776; RP3-393D12.2) (Biotin); anti-FHL5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G12-D2
Specificity
Recognizes human FHL5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-FHL5 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-284 from FHL5 (AAH21723) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSDCRKDLCEEQFMSRDDYPFCMDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (56.98kD).)

Western Blot (WB) (Western Blot detection against Immunogen (56.98kD).)

Western Blot (WB)

(Western Blot analysis of FHL5 expression in transfected 293T cell line by FHL5 monoclonal antibody. Lane 1: FHL5 transfected lysate (32.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FHL5 expression in transfected 293T cell line by FHL5 monoclonal antibody. Lane 1: FHL5 transfected lysate (32.8kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FHL5 on HepG2 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FHL5 on HepG2 cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-FHL5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
32,720 Da
NCBI Official Full Name
Homo sapiens four and a half LIM domains 5, mRNA
NCBI Official Synonym Full Names
four and a half LIM domains 5
NCBI Official Symbol
FHL5
NCBI Official Synonym Symbols
ACT; FHL-5; dJ393D12.2; 1700027G07Rik
NCBI Protein Information
four and a half LIM domains protein 5

NCBI Description

The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM). It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for the differentiation of spermatids into mature spermatozoa. There are multiple polyadenylation sites found in this gene. Polymorphisms in this gene may be associated with susceptibility for migraine headaches. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Apr 2016]

Research Articles on FHL5

Similar Products

Product Notes

The FHL5 (Catalog #AAA6140457) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FHL5 (Four and a Half LIM Domains Protein 5, FHL-5, Activator of cAMP-responsive Element Modulator in Testis, Activator of CREM in Testis, ACT, dJ393D12.2, FLJ33049, KIAA0776, RP3-393D12.2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FHL5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FHL5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FHL5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.