Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Mouse anti-Human FHL3 Monoclonal Antibody | anti-FHL3 antibody
FHL3 (Four And A Half LIM Domains Protein 3, FHL-3, Skeletal Muscle LIM-protein 2, SLIM 2, SLIM2) (FITC)
Gene Names
FHL3; SLIM2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FHL3; Monoclonal Antibody; FHL3 (Four And A Half LIM Domains Protein 3; FHL-3; Skeletal Muscle LIM-protein 2; SLIM 2; SLIM2) (FITC); anti-FHL3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C10
Specificity
Recognizes human FHL3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-FHL3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa3-102 from human FHL3 (NP_004459.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.74kD).)
Testing Data
(Detection limit for recombinant GST tagged FHL3 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged FHL3 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-FHL3 antibody
FHL3 are defined by the possession of a highly conserved double zinc finger motif called the LIM domain.
Product Categories/Family for anti-FHL3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,192 Da
NCBI Official Full Name
four and a half LIM domains protein 3 isoform 1
NCBI Official Synonym Full Names
four and a half LIM domains 3
NCBI Official Symbol
FHL3
NCBI Official Synonym Symbols
SLIM2
NCBI Protein Information
four and a half LIM domains protein 3
Protein Family
NCBI Description
The protein encoded by this gene is a member of a family of proteins containing a four-and-a-half LIM domain, which is a highly conserved double zinc finger motif. The encoded protein has been shown to interact with the cancer developmental regulators SMAD2, SMAD3, and SMAD4, the skeletal muscle myogenesis protein MyoD, and the high-affinity IgE beta chain regulator MZF-1. This protein may be involved in tumor suppression, repression of MyoD expression, and repression of IgE receptor expression. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Research Articles on FHL3
Similar Products
Product Notes
The FHL3 (Catalog #AAA6147210) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FHL3 (Four And A Half LIM Domains Protein 3, FHL-3, Skeletal Muscle LIM-protein 2, SLIM 2, SLIM2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FHL3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FHL3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FHL3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
