Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human FHIT Monoclonal Antibody | anti-FHIT antibody

FHIT (Fragile Histidine Triad Protein, AP3A Hydrolase, AP3Aase, Bis(5'-adenosyl)-triphosphatase, Diadenosine 5',5'''-P1,P3-triphosphate Hydrolase, Dinucleosidetriphosphatase, FRA3B) APC

Gene Names
FHIT; FRA3B; AP3Aase
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FHIT; Monoclonal Antibody; FHIT (Fragile Histidine Triad Protein; AP3A Hydrolase; AP3Aase; Bis(5'-adenosyl)-triphosphatase; Diadenosine 5'; 5'''-P1; P3-triphosphate Hydrolase; Dinucleosidetriphosphatase; FRA3B) APC; anti-FHIT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E3
Specificity
Recognizes human FHIT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-FHIT antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa31-130 from human FHIT (AAH32336) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(FHIT monoclonal antibody, Western Blot analysis of FHIT expression in HL-60.)

Western Blot (WB) (FHIT monoclonal antibody, Western Blot analysis of FHIT expression in HL-60.)

Testing Data

(Detection limit for recombinant GST tagged FHIT is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FHIT is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-FHIT antibody
FHIT is a putative human tumor suppressor gene at chromosome 3p14.2 that was identified recently by positional cloning. Homozygous deletions within the FHIT locus have been observed in cell lines derived from cancers of the esophagus, stomach, colon, breast, kidney, and lung, and aberrant transcripts were observed in several types of primary tumors. This gene also encompasses the site of the t (3; 8) translocation breakpoint of familial renal clear cell carcinoma and the fragile site locus FRA3B. The1.1-kb FHIT cDNA is encoded by 10 small exons distributed over a genomic locus of about 1 Mb; the t (3;8) break falls between untranslated 5' exons 3 and 4. The protein is a dinucleoside 5', 5'''-P1, P3-triphosphate hydrolase and the histidine residues of the HIT sequence are critical for the Ap3A hydrolase activity of Fhit.
Product Categories/Family for anti-FHIT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
16,858 Da
NCBI Official Full Name
Homo sapiens fragile histidine triad gene, mRNA
NCBI Official Synonym Full Names
fragile histidine triad
NCBI Official Symbol
FHIT
NCBI Official Synonym Symbols
FRA3B; AP3Aase

NCBI Description

This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2009]

Similar Products

Product Notes

The FHIT (Catalog #AAA6136601) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FHIT (Fragile Histidine Triad Protein, AP3A Hydrolase, AP3Aase, Bis(5'-adenosyl)-triphosphatase, Diadenosine 5',5'''-P1,P3-triphosphate Hydrolase, Dinucleosidetriphosphatase, FRA3B) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FHIT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FHIT for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FHIT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.