Mouse anti-Human FHIT Monoclonal Antibody | anti-FHIT antibody

FHIT (Fragile Histidine Triad Protein, AP3A Hydrolase, AP3Aase, Bis(5'-adenosyl)-triphosphatase, Diadenosine 5',5'''-P1,P3-triphosphate Hydrolase, Dinucleosidetriphosphatase, FRA3B) (PE)

Cat. Num. AAA6157813

• Gene Names: FHIT; FRA3B; AP3Aase
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FHIT; Monoclonal Antibody; FHIT (Fragile Histidine Triad Protein; AP3A Hydrolase; AP3Aase; Bis(5'-adenosyl)-triphosphatase; Diadenosine 5'; 5'''-P1; P3-triphosphate Hydrolase; Dinucleosidetriphosphatase; FRA3B) (PE); anti-FHIT antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1E3
• Specificity: Recognizes human FHIT.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-FHIT antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa31-130 from human FHIT (AAH32336) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(FHIT monoclonal antibody, Western Blot analysis of FHIT expression in HL-60.)

Testing Data

(Detection limit for recombinant GST tagged FHIT is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-FHIT antibody

FHIT is a putative human tumor suppressor gene at chromosome 3p14.2 that was identified recently by positional cloning. Homozygous deletions within the FHIT locus have been observed in cell lines derived from cancers of the esophagus, stomach, colon, breast, kidney, and lung, and aberrant transcripts were observed in several types of primary tumors. This gene also encompasses the site of the t (3; 8) translocation breakpoint of familial renal clear cell carcinoma and the fragile site locus FRA3B. The1.1-kb FHIT cDNA is encoded by 10 small exons distributed over a genomic locus of about 1 Mb; the t (3;8) break falls between untranslated 5' exons 3 and 4. The protein is a dinucleoside 5', 5'''-P1, P3-triphosphate hydrolase and the histidine residues of the HIT sequence are critical for the Ap3A hydrolase activity of Fhit.

Product Categories/Family for anti-FHIT antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 21595363
• NCBI GeneID: 2272
• Molecular Weight: 16,858 Da
• NCBI Official Full Name: Homo sapiens fragile histidine triad gene, mRNA
• NCBI Official Synonym Full Names: fragile histidine triad
• NCBI Official Symbol: FHIT
• NCBI Official Synonym Symbols: FRA3B; AP3Aase
• Protein Family: Bis(5'-adenosyl)-triphosphatase

NCBI Description

This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2009]