Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human FBXW7 Monoclonal Antibody | anti-FBXW7 antibody

FBXW7 (F-box and WD-40 Domain Protein 7, F-box and WD-40 Domain-containing Protein 7, F-box Protein FBW7, F-box/WD Repeat Protein 7, FBW7, Archipelago Drosophila Homolog of, Archipelago Homolog, AGO, CDC4, DKFZp686F23254, F-box Protein FBX30, FBX30, FBXO3

Gene Names
FBXW7; AGO; CDC4; FBW6; FBW7; hAgo; FBX30; FBXW6; SEL10; hCdc4; FBXO30; SEL-10
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FBXW7; Monoclonal Antibody; FBXW7 (F-box and WD-40 Domain Protein 7; F-box and WD-40 Domain-containing Protein 7; F-box Protein FBW7; F-box/WD Repeat Protein 7; FBW7; Archipelago Drosophila Homolog of; Archipelago Homolog; AGO; CDC4; DKFZp686F23254; F-box Protein FBX30; FBX30; FBXO3; anti-FBXW7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D1
Specificity
Recognizes human FBXW7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
707
Applicable Applications for anti-FBXW7 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa599-708 from human FBXW7 (NP_361014) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-FBXW7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
F-box/WD repeat-containing protein 7 isoform 1
NCBI Official Synonym Full Names
F-box and WD repeat domain containing 7
NCBI Official Symbol
FBXW7
NCBI Official Synonym Symbols
AGO; CDC4; FBW6; FBW7; hAgo; FBX30; FBXW6; SEL10; hCdc4; FBXO30; SEL-10
NCBI Protein Information
F-box/WD repeat-containing protein 7
UniProt Protein Name
F-box/WD repeat-containing protein 7
UniProt Gene Name
FBXW7
UniProt Synonym Gene Names
FBW7; FBX30; SEL10; hAgo
UniProt Entry Name
FBXW7_HUMAN

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene was previously referred to as FBX30, and belongs to the Fbws class; in addition to an F-box, this protein contains 7 tandem WD40 repeats. This protein binds directly to cyclin E and probably targets cyclin E for ubiquitin-mediated degradation. Mutations in this gene are detected in ovarian and breast cancer cell lines, implicating the gene's potential role in the pathogenesis of human cancers. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012]

Research Articles on FBXW7

Similar Products

Product Notes

The FBXW7 fbxw7 (Catalog #AAA6200810) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBXW7 (F-box and WD-40 Domain Protein 7, F-box and WD-40 Domain-containing Protein 7, F-box Protein FBW7, F-box/WD Repeat Protein 7, FBW7, Archipelago Drosophila Homolog of, Archipelago Homolog, AGO, CDC4, DKFZp686F23254, F-box Protein FBX30, FBX30, FBXO3 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXW7 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FBXW7 fbxw7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBXW7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.