Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human FBLN1 Monoclonal Antibody | anti-FBLN1 antibody

FBLN1 (Fibulin 1, FBLN, Fibulin-1, FIBL-1, PP213) (FITC)

Gene Names
FBLN1; FBLN; FIBL1
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FBLN1; Monoclonal Antibody; FBLN1 (Fibulin 1; FBLN; Fibulin-1; FIBL-1; PP213) (FITC); anti-FBLN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C9
Specificity
Recognizes human FBLN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
2266
Applicable Applications for anti-FBLN1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa151-250 from human FBLN1 (AAH22497) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGT
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(FBLN1 monoclonal antibody, Western Blot analysis of FBLN1 expression in A-431.)

Western Blot (WB) (FBLN1 monoclonal antibody, Western Blot analysis of FBLN1 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of FBLN1 expression in transfected 293T cell line by FBLN1 monoclonal antibody. Lane 1: FBLN1 transfected lysate (74.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FBLN1 expression in transfected 293T cell line by FBLN1 monoclonal antibody. Lane 1: FBLN1 transfected lysate (74.4kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of FBLN1 transfected lysate using FBLN1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FBLN1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of FBLN1 transfected lysate using FBLN1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FBLN1 rabbit polyclonal antibody.)
Related Product Information for anti-FBLN1 antibody
Incorporated into fibronectin-containing matrix fibers. May play a role in cell adhesion and migration along protein fibers within the extracellular matrix (ECM). Could be important for certain developmental processes and contribute to the supramolecular organization of ECM architecture, in particular to those of basement membranes. Has been implicated in a role in cellular transformation and tumor invasion, it appears to be a tumor suppressor. May play a role in haemostasis and thrombosis owing to its ability to bind fibrinogen and incorporate into clots. Could play a significant role in modulating the neurotrophic activities of APP, particularly soluble APP.
Product Categories/Family for anti-FBLN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens fibulin 1, mRNA
NCBI Official Synonym Full Names
fibulin 1
NCBI Official Symbol
FBLN1
NCBI Official Synonym Symbols
FBLN; FIBL1
NCBI Protein Information
fibulin-1

NCBI Description

Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen. Four splice variants which differ in the 3' end have been identified. Each variant encodes a different isoform, but no functional distinctions have been identified among the four variants. [provided by RefSeq, Jul 2008]

Research Articles on FBLN1

Similar Products

Product Notes

The FBLN1 (Catalog #AAA6147152) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBLN1 (Fibulin 1, FBLN, Fibulin-1, FIBL-1, PP213) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBLN1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FBLN1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBLN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.