Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human FAS Monoclonal Antibody | anti-FAS antibody

FAS (Tumor Necrosis Factor Receptor Superfamily Member 6, TNFRSF6, Apo-1 Antigen, Apoptosis-mediating Surface Antigen FAS, FASLG Receptor, CD95, APT1, FAS1, TNFRSF6) (MaxLight 405)

Gene Names
FAS; APT1; CD95; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FAS; Monoclonal Antibody; FAS (Tumor Necrosis Factor Receptor Superfamily Member 6; TNFRSF6; Apo-1 Antigen; Apoptosis-mediating Surface Antigen FAS; FASLG Receptor; CD95; APT1; FAS1; TNFRSF6) (MaxLight 405); anti-FAS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G3
Specificity
Recognizes human FAS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-FAS antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa20-119 from human FAS (NP_000034) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINC
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-FAS antibody
FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells.
Product Categories/Family for anti-FAS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
355
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17.7kDa (156aa) 18-28KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 6 isoform 1
NCBI Official Synonym Full Names
Fas cell surface death receptor
NCBI Official Symbol
FAS
NCBI Official Synonym Symbols
APT1; CD95; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6
NCBI Protein Information
tumor necrosis factor receptor superfamily member 6
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 6
Protein Family
UniProt Gene Name
FAS
UniProt Synonym Gene Names
APT1; FAS1; TNFRSF6
UniProt Entry Name
TNR6_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. Several alternatively spliced transcript variants have been described, some of which are candidates for nonsense-mediated mRNA decay (NMD). The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform. [provided by RefSeq, Mar 2011]

Uniprot Description

FAS: Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death- inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS- mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro). Binds DAXX. Interacts with HIPK3. Part of a complex containing HIPK3 and FADD. Binds RIPK1 and FAIM2. Interacts with BRE and FEM1B. Interacts with FADD. Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine; Cell surface; Apoptosis

Chromosomal Location of Human Ortholog: 10q24.1

Cellular Component: cell surface; cytoplasm; integral to membrane; plasma membrane; CD95 death-inducing signaling complex; nucleus; cytosol; lipid raft; external side of plasma membrane

Molecular Function: identical protein binding; protein binding; signal transducer activity; transmembrane receptor activity; receptor activity; kinase binding

Biological Process: spleen development; caspase activation; circadian rhythm; regulation of myeloid cell differentiation; renal system process; transformed cell apoptosis; positive regulation of protein homooligomerization; positive regulation of apoptosis; apoptosis; regulation of lymphocyte differentiation; response to toxin; response to glucocorticoid stimulus; negative regulation of B cell activation; signal transduction; negative thymic T cell selection; regulation of apoptosis; inflammatory cell apoptosis; B cell mediated immunity; induction of apoptosis via death domain receptors; protein complex assembly; gene expression; immunoglobulin production; activated T cell apoptosis; protein homooligomerization; negative regulation of apoptosis

Disease: Autoimmune Lymphoproliferative Syndrome

Research Articles on FAS

Similar Products

Product Notes

The FAS fas (Catalog #AAA6190102) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FAS (Tumor Necrosis Factor Receptor Superfamily Member 6, TNFRSF6, Apo-1 Antigen, Apoptosis-mediating Surface Antigen FAS, FASLG Receptor, CD95, APT1, FAS1, TNFRSF6) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FAS can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FAS fas for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FAS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.