<
Western Blot (WB)
(FAM3B monoclonal antibody. Western Blot analysis of FAM3B expression in human kidney.)
Mouse anti-Human FAM3B Monoclonal Antibody | anti-FAM3B antibody
FAM3B (Protein FAM3B, Cytokine-like Protein 2-21, Pancreatic-derived Factor, PANDER, UNQ320/PRO365, PRED44, C21orf76, C21orf11, D21M16SJHU19e) APC
Gene Names
FAM3B; 2-21; ORF9; PANDER; PRED44; C21orf11; C21orf76
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FAM3B; Monoclonal Antibody; FAM3B (Protein FAM3B; Cytokine-like Protein 2-21; Pancreatic-derived Factor; PANDER; UNQ320/PRO365; PRED44; C21orf76; C21orf11; D21M16SJHU19e) APC; anti-FAM3B antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E7
Specificity
Recognizes human FAM3B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-FAM3B antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-236 from human FAM3B (AAH57829) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(FAM3B monoclonal antibody. Western Blot analysis of FAM3B expression in human kidney.)
Western Blot (WB)
(FAM3B monoclonal antibody. Western Blot analysis of FAM3B expression in human kidney.)
Western Blot (WB)
(Western Blot analysis of FAM3B expression in transfected 293T cell line by FAM3B monoclonal antibody. Lane 1: FAM3B transfected lysate (26kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of FAM3B expression in transfected 293T cell line by FAM3B monoclonal antibody. Lane 1: FAM3B transfected lysate (26kD). Lane 2: Non-transfected lysate.)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to FAM3B on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to FAM3B on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)
Immunoprecipitation (IP)
(Immunoprecipitation of FAM3B transfected lysate using FAM3B monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FAM3B rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of FAM3B transfected lysate using FAM3B monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FAM3B rabbit polyclonal antibody.)
Testing Data
(Detection limit for recombinant GST tagged FAM3B is 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged FAM3B is 1ng/ml as a capture antibody.)
Western Blot (WB)
(Western Blot detection against Immunogen (51.96kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (51.96kD).)
Product Categories/Family for anti-FAM3B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
20,815 Da
NCBI Official Full Name
Homo sapiens family with sequence similarity 3, member B, mRNA
NCBI Official Synonym Full Names
family with sequence similarity 3 member B
NCBI Official Symbol
FAM3B
NCBI Official Synonym Symbols
2-21; ORF9; PANDER; PRED44; C21orf11; C21orf76
NCBI Protein Information
protein FAM3B
Protein Family
Research Articles on FAM3B
Similar Products
Product Notes
The FAM3B (Catalog #AAA6136530) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FAM3B (Protein FAM3B, Cytokine-like Protein 2-21, Pancreatic-derived Factor, PANDER, UNQ320/PRO365, PRED44, C21orf76, C21orf11, D21M16SJHU19e) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FAM3B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FAM3B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FAM3B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
