SDS-PAGE
COMM domain-containing protein 4 Recombinant Protein | COMMD4 recombinant protein
Recombinant human COMM domain-containing protein 4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
COMM domain-containing protein 4; Recombinant human COMM domain-containing protein 4; COMMD4 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for COMMD4 recombinant protein
Down-regulates activation of NF-kappa-B. Ref.1
References
[1] "COMMD proteins, a novel family of structural and functional homologs of MURR1."
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48 KD
NCBI Official Full Name
COMM domain-containing protein 4
NCBI Official Synonym Full Names
COMM domain containing 4
NCBI Official Symbol
COMMD4
NCBI Protein Information
COMM domain-containing protein 4
UniProt Protein Name
COMM domain-containing protein 4
Protein Family
UniProt Gene Name
COMMD4
UniProt Entry Name
COMD4_HUMAN
Uniprot Description
Function: Down-regulates activation of NF-kappa-B. Ref.1
Subunit structure: Interacts (via COMM domain) with COMMD1 (via COMM domain). Ref.1
Tissue specificity: Ubiquitous. Ref.1
Sequence similarities: Contains 1 COMM domain.
Similar Products
Product Notes
The COMMD4 commd4 (Catalog #AAA717323) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MRFRFCGDLD CPDWVLAEIS TLAKMSSVKL RLLCSQVLKE LLGQGIDYEK ILKLTADAKF ESGDVKATVA VLSFILSSAA KHSVDGESLS SELQQLGLPK EHAASLCRCY EEKQSPLQKH LRVCSLRMNR LAGVGWRVDY TLSSSLLQSV EEPMVHLRLE VAAAPGTPAQ PVAMSLSADK FQVLLAELKQ AQTLM. It is sometimes possible for the material contained within the vial of "COMM domain-containing protein 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
