Mouse anti-Human F11 Monoclonal Antibody | anti-F11 antibody

F11 (Coagulation Factor XI, FXI, Plasma Thromboplastin Antecedent, PTA, MGC141891) (HRP)

Cat. Num. AAA6152418

• Gene Names: F11; FXI
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: F11; Monoclonal Antibody; F11 (Coagulation Factor XI; FXI; Plasma Thromboplastin Antecedent; PTA; MGC141891) (HRP); anti-F11 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2H8
• Specificity: Recognizes human F11.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-F11 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa286-385 from human F11 (NP_000119) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of F11 expression in transfected 293T cell line by F11 monoclonal antibody. Lane 1: F11 transfected lysate (70.1kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of F11 transfected lysate using F11 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with F11 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged F11 is ~10ng/ml as a capture antibody.)

Related Product Information for anti-F11 antibody

Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.

Product Categories/Family for anti-F11 antibody

Antibodies; Coagulation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4503627
• NCBI GeneID: 2160
• NCBI Accession #: NP_000119
• NCBI GenBank Nucleotide #: NM_000128
• UniProt Accession #: P03951; Q4W5C2; Q9Y495; D3DP64
• Molecular Weight: 63,840 Da
• NCBI Official Full Name: coagulation factor XI
• NCBI Official Synonym Full Names: coagulation factor XI
• NCBI Official Symbol: F11
• NCBI Official Synonym Symbols: FXI
• NCBI Protein Information: coagulation factor XI; PTA; plasma thromboplastin antecedent
• UniProt Protein Name: Coagulation factor XI
• Protein Family: Coagulation factor
• UniProt Gene Name: F11
• UniProt Synonym Gene Names: FXI; PTA
• UniProt Entry Name: FA11_HUMAN

Uniprot Description

F11: Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX. Defects in F11 are the cause of factor XI deficiency (FA11D); also known as plasma thromboplastin antecedent deficiency or Rosenthal syndrome. It is a hemorrhagic disease characterized by reduced levels and activity of factor XI resulting in moderate bleeding symptoms, usually occurring after trauma or surgery. Patients usually do not present spontaneous bleeding but women can present with menorrhagia. Hemorrhages are usually moderate. Belongs to the peptidase S1 family. Plasma kallikrein subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted; EC 3.4.21.27; Protease

Chromosomal Location of Human Ortholog: 4q35

Cellular Component: extracellular space; membrane; plasma membrane; extracellular region

Molecular Function: heparin binding; protein binding; serine-type endopeptidase activity

Biological Process: positive regulation of fibrinolysis; proteolysis; blood coagulation; blood coagulation, intrinsic pathway; plasminogen activation

Disease: Factor Xi Deficiency