Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse EXOC4 Monoclonal Antibody | anti-EXOC4 antibody

EXOC4 (Exocyst Complex Component 4, Exocyst Complex Component Sec8, KIAA1699, SEC8, SEC8L1, MGC27170) APC

Gene Names
EXOC4; SEC8; Sec8p; SEC8L1
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EXOC4; Monoclonal Antibody; EXOC4 (Exocyst Complex Component 4; Exocyst Complex Component Sec8; KIAA1699; SEC8; SEC8L1; MGC27170) APC; anti-EXOC4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F1
Specificity
Recognizes human EXOC4. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
974
Applicable Applications for anti-EXOC4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human EXOC4 (NP_068579) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRD
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB)

(EXOC4 monoclonal antibody. Western Blot analysis of EXOC4 expression in PC-12.)

Western Blot (WB) (EXOC4 monoclonal antibody. Western Blot analysis of EXOC4 expression in PC-12.)

Western Blot (WB)

(EXOC4 monoclonal antibody, Western Blot analysis of EXOC4 expression in Hela NE.)

Western Blot (WB) (EXOC4 monoclonal antibody, Western Blot analysis of EXOC4 expression in Hela NE.)

Western Blot (WB)

(EXOC4 monoclonal antibody. Western Blot analysis of EXOC4 expression in NIH/3T3.)

Western Blot (WB) (EXOC4 monoclonal antibody. Western Blot analysis of EXOC4 expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged EXOC4 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EXOC4 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(EXOC4 monoclonal antibody. Western Blot analysis of EXOC4 expression in Raw 264.7.)

Western Blot (WB) (EXOC4 monoclonal antibody. Western Blot analysis of EXOC4 expression in Raw 264.7.)
Related Product Information for anti-EXOC4 antibody
The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]
Product Categories/Family for anti-EXOC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
exocyst complex component 4 isoform a
NCBI Official Synonym Full Names
exocyst complex component 4
NCBI Official Symbol
EXOC4
NCBI Official Synonym Symbols
SEC8; Sec8p; SEC8L1
NCBI Protein Information
exocyst complex component 4
UniProt Protein Name
Exocyst complex component 4
UniProt Gene Name
EXOC4
UniProt Synonym Gene Names
KIAA1699; SEC8; SEC8L1
UniProt Entry Name
EXOC4_HUMAN

NCBI Description

The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Research Articles on EXOC4

Similar Products

Product Notes

The EXOC4 exoc4 (Catalog #AAA6136495) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EXOC4 (Exocyst Complex Component 4, Exocyst Complex Component Sec8, KIAA1699, SEC8, SEC8L1, MGC27170) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EXOC4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EXOC4 exoc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EXOC4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.