Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human EXOC3 Monoclonal Antibody | anti-EXOC3 antibody

EXOC3 (Exocyst Complex Component 3, Exocyst Complex Component Sec6, SEC6, SEC6L1)

Gene Names
EXOC3; SEC6; Sec6p; SEC6L1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
EXOC3; Monoclonal Antibody; EXOC3 (Exocyst Complex Component 3; Exocyst Complex Component Sec6; SEC6; SEC6L1); Anti -EXOC3 (Exocyst Complex Component 3; anti-EXOC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4A7
Specificity
Recognizes human EXOC3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SGFGEDVDGYCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLAVRGDASRDMKQTIMETLEQGPAQASPSYVPLFKDIVVPSLNVAKLLK*
Applicable Applications for anti-EXOC3 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa646-746 from XOC3 (NP_009208) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of EXOC3 expression in transfected 293T cell line by EXOC3 monoclonal antibody.|Lane 1: EXOC3 transfected lysate (86.845kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EXOC3 expression in transfected 293T cell line by EXOC3 monoclonal antibody.|Lane 1: EXOC3 transfected lysate (86.845kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged EXOC3 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EXOC3 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-EXOC3 antibody
Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.
Product Categories/Family for anti-EXOC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
86,845 Da
NCBI Official Full Name
EXOC3 protein, partial
NCBI Official Synonym Full Names
exocyst complex component 3
NCBI Official Symbol
EXOC3
NCBI Official Synonym Symbols
SEC6; Sec6p; SEC6L1
NCBI Protein Information
exocyst complex component 3; SEC6-like 1; Sec 6 homolog; exocyst complex component Sec6
UniProt Protein Name
Exocyst complex component 3
Protein Family
UniProt Gene Name
EXOC3
UniProt Synonym Gene Names
SEC6; SEC6L1
UniProt Entry Name
EXOC3_HUMAN

NCBI Description

The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. [provided by RefSeq, Jul 2008]

Uniprot Description

SEC6L1: Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane. Belongs to the SEC6 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 5p15.33

Cellular Component: secretory granule membrane; exocyst; cytosol

Molecular Function: protein binding; SNARE binding

Biological Process: protein transport; exocytosis; cellular protein metabolic process; organelle organization and biogenesis; exocyst localization

Research Articles on EXOC3

Similar Products

Product Notes

The EXOC3 exoc3 (Catalog #AAA6010901) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EXOC3 (Exocyst Complex Component 3, Exocyst Complex Component Sec6, SEC6, SEC6L1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EXOC3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the EXOC3 exoc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SGFGEDVDGY CDTIVAVAEV IKLTDPSLLY LEVSTLVSKY PDIRDDHIGA LLAVRGDASR DMKQTIMETL EQGPAQASPS YVPLFKDIVV PSLNVAKLLK *. It is sometimes possible for the material contained within the vial of "EXOC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.