Testing Data
(Detection limit for recombinant GST tagged EXO1 is approximately 1ng/ml as a capture antibody.)
Mouse EXO1 Monoclonal Antibody | anti-EXO1 antibody
EXO1 (Exonuclease 1, HEX1, hExoI) (HRP)
Gene Names
EXO1; HEX1; hExoI
Applications
Western Blot
Purity
Purified
Synonyms
EXO1; Monoclonal Antibody; EXO1 (Exonuclease 1; HEX1; hExoI) (HRP); Exonuclease 1; hExoI; anti-EXO1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1H6
Specificity
Recognizes EXO1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
846
Applicable Applications for anti-EXO1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EXO1 (AAH07491, 747aa-846aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ADSLSTTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRVQRAIFQ
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged EXO1 is approximately 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged EXO1 is approximately 1ng/ml as a capture antibody.)
Product Categories/Family for anti-EXO1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Exonuclease 1
NCBI Official Synonym Full Names
exonuclease 1
NCBI Official Symbol
EXO1
NCBI Official Synonym Symbols
HEX1; hExoI
NCBI Protein Information
exonuclease 1
Protein Family
NCBI Description
This gene encodes a protein with 5' to 3' exonuclease activity as well as an RNase H activity. It is similar to the Saccharomyces cerevisiae protein Exo1 which interacts with Msh2 and which is involved in mismatch repair and recombination. Alternative splicing of this gene results in three transcript variants encoding two different isoforms. [provided by RefSeq, Jul 2008]
Research Articles on EXO1
Similar Products
Product Notes
The EXO1 (Catalog #AAA6181679) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EXO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EXO1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EXO1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
