Mouse anti-Human ETV1 Monoclonal Antibody | anti-ETV1 antibody

ETV1 (ETS Translocation Variant 1, Ets-related Protein 81, ER81) (HRP)

Cat. Num. AAA6152393

• Gene Names: ETV1; ER81
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ETV1; Monoclonal Antibody; ETV1 (ETS Translocation Variant 1; Ets-related Protein 81; ER81) (HRP); anti-ETV1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A8
• Specificity: Recognizes human ETV1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-ETV1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~1ng/ml as a capture antibody.; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa148-257 from ETV1 (NP_004947) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD))

Western Blot (WB)

(ETV1 monoclonal antibody. Western Blot analysis of ETV1 expression in human liver.)

Testing Data

(Detection limit for recombinant GST tagged ETV1 is ~1ng/ml as a capture antibody)

Product Categories/Family for anti-ETV1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 31742534
• NCBI GeneID: 2115
• NCBI Accession #: NP_004947
• NCBI GenBank Nucleotide #: NM_004956
• UniProt Accession #: P50549
• Molecular Weight: 55kDa
• NCBI Official Full Name: ETS translocation variant 1 isoform a
• NCBI Official Synonym Full Names: ETS variant 1
• NCBI Official Symbol: ETV1
• NCBI Official Synonym Symbols: ER81
• NCBI Protein Information: ETS translocation variant 1
• UniProt Protein Name: ETS translocation variant 1
• Protein Family: ETS translocation
• UniProt Gene Name: ETV1
• UniProt Synonym Gene Names: ER81
• UniProt Entry Name: ETV1_HUMAN

NCBI Description

This gene encodes a member of the ETS (E twenty-six) family of transcription factors. The ETS proteins regulate many target genes that modulate biological processes like cell growth, angiogenesis, migration, proliferation and differentiation. All ETS proteins contain an ETS DNA-binding domain that binds to DNA sequences containing the consensus 5'-CGGA[AT]-3'. The protein encoded by this gene contains a conserved short acidic transactivation domain (TAD) in the N-terminal region, in addition to the ETS DNA-binding domain in the C-terminal region. This gene is involved in chromosomal translocations, which result in multiple fusion proteins including EWS-ETV1 in Ewing sarcoma and at least 10 ETV1 partners (see PMID: 19657377, Table 1) in prostate cancer. In addition to chromosomal rearrangement, this gene is overexpressed in prostate cancer, melanoma and gastrointestinal stromal tumor. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2016]

Uniprot Description

ETV1: Transcriptional activator that binds to DNA sequences containing the consensus pentanucleotide 5'-CGGA[AT]-3'. Defects in ETV1 are a cause of Ewing sarcoma (ES). A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors. A chromosomal aberration involving ETV1 is found in patients with Erwing sarcoma. Translocation t(7;22)(p22;q12) with EWSR1. Belongs to the ETS family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 7p21.3

Cellular Component: nucleus

Molecular Function: protein binding; transcription factor activity

Biological Process: peripheral nervous system neuron development; transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; axon guidance; muscle development; mechanosensory behavior; positive regulation of transcription from RNA polymerase II promoter; cell differentiation