Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD))

Mouse anti-Human ETV1 Monoclonal Antibody | anti-ETV1 antibody

ETV1 (ETS Translocation Variant 1, Ets-related Protein 81, ER81) (FITC)

Gene Names
ETV1; ER81
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ETV1; Monoclonal Antibody; ETV1 (ETS Translocation Variant 1; Ets-related Protein 81; ER81) (FITC); anti-ETV1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A8
Specificity
Recognizes human ETV1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ETV1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~1ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa148-257 from ETV1 (NP_004947) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD))

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD))

Western Blot (WB)

(ETV1 monoclonal antibody. Western Blot analysis of ETV1 expression in human liver.)

Western Blot (WB) (ETV1 monoclonal antibody. Western Blot analysis of ETV1 expression in human liver.)

Testing Data

(Detection limit for recombinant GST tagged ETV1 is ~1ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged ETV1 is ~1ng/ml as a capture antibody)
Product Categories/Family for anti-ETV1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
ETS translocation variant 1 isoform a
NCBI Official Synonym Full Names
ETS variant 1
NCBI Official Symbol
ETV1
NCBI Official Synonym Symbols
ER81
NCBI Protein Information
ETS translocation variant 1
UniProt Protein Name
ETS translocation variant 1
Protein Family
UniProt Gene Name
ETV1
UniProt Synonym Gene Names
ER81
UniProt Entry Name
ETV1_HUMAN

NCBI Description

This gene encodes a member of the ETS (E twenty-six) family of transcription factors. The ETS proteins regulate many target genes that modulate biological processes like cell growth, angiogenesis, migration, proliferation and differentiation. All ETS proteins contain an ETS DNA-binding domain that binds to DNA sequences containing the consensus 5'-CGGA[AT]-3'. The protein encoded by this gene contains a conserved short acidic transactivation domain (TAD) in the N-terminal region, in addition to the ETS DNA-binding domain in the C-terminal region. This gene is involved in chromosomal translocations, which result in multiple fusion proteins including EWS-ETV1 in Ewing sarcoma and at least 10 ETV1 partners (see PMID: 19657377, Table 1) in prostate cancer. In addition to chromosomal rearrangement, this gene is overexpressed in prostate cancer, melanoma and gastrointestinal stromal tumor. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2016]

Uniprot Description

ETV1: Transcriptional activator that binds to DNA sequences containing the consensus pentanucleotide 5'-CGGA[AT]-3'. Defects in ETV1 are a cause of Ewing sarcoma (ES). A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors. A chromosomal aberration involving ETV1 is found in patients with Erwing sarcoma. Translocation t(7;22)(p22;q12) with EWSR1. Belongs to the ETS family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 7p21.3

Cellular Component: nucleus

Molecular Function: protein binding; transcription factor activity

Biological Process: peripheral nervous system neuron development; transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; axon guidance; muscle development; mechanosensory behavior; positive regulation of transcription from RNA polymerase II promoter; cell differentiation

Research Articles on ETV1

Similar Products

Product Notes

The ETV1 etv1 (Catalog #AAA6147090) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ETV1 (ETS Translocation Variant 1, Ets-related Protein 81, ER81) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ETV1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~1ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ETV1 etv1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ETV1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.