Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ESD Monoclonal Antibody | anti-ESD antibody

ESD (S-formylglutathione Hydrolase, FGH, Esterase D) (MaxLight 405)

Gene Names
ESD; FGH
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ESD; Monoclonal Antibody; ESD (S-formylglutathione Hydrolase; FGH; Esterase D) (MaxLight 405); anti-ESD antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E1
Specificity
Recognizes human ESD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-ESD antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa183-281 from human ESD (NP_001975.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLN
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ESD antibody
ESD belongs to the esterase D family. This protein is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids.
Product Categories/Family for anti-ESD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,463 Da
NCBI Official Full Name
S-formylglutathione hydrolase
NCBI Official Synonym Full Names
esterase D
NCBI Official Symbol
ESD
NCBI Official Synonym Symbols
FGH
NCBI Protein Information
S-formylglutathione hydrolase; esterase 10; esterase D/formylglutathione hydrolase; methylumbelliferyl-acetate deacetylase
UniProt Protein Name
S-formylglutathione hydrolase
UniProt Gene Name
ESD
UniProt Synonym Gene Names
FGH
UniProt Entry Name
ESTD_HUMAN

NCBI Description

This gene encodes a serine hydrolase that belongs to the esterase D family. The encoded enzyme is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. This gene is used as a genetic marker for retinoblastoma and Wilson's disease. [provided by RefSeq, Feb 2009]

Uniprot Description

esterase D: an enzyme that catalyzes the conversion of carboxylic esters and H2O into alcohol and a carboxylic anion.

Protein type: EC 3.1.2.12; EC 3.1.1.56; Hydrolase

Chromosomal Location of Human Ortholog: 13q14.1-q14.2

Cellular Component: nucleoplasm; Golgi apparatus; cytoplasmic membrane-bound vesicle; cytoplasm; plasma membrane

Molecular Function: S-formylglutathione hydrolase activity; methylumbelliferyl-acetate deacetylase activity; hydrolase activity, acting on ester bonds

Biological Process: formaldehyde catabolic process

Research Articles on ESD

Similar Products

Product Notes

The ESD esd (Catalog #AAA6190035) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ESD (S-formylglutathione Hydrolase, FGH, Esterase D) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ESD can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ESD esd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ESD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.