Mouse anti-Human ERRFI1 Monoclonal Antibody | anti-ERRFI1 antibody

ERRFI1 (MIG6, ERBB Receptor Feedback Inhibitor 1, Mitogen-inducible Gene 6 Protein, GENE-33, MIG-6, RALT) (Biotin)

Cat. Num. AAA6141776

• Gene Names: ERRFI1; MIG6; RALT; MIG-6; GENE-33
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ERRFI1; Monoclonal Antibody; ERRFI1 (MIG6; ERBB Receptor Feedback Inhibitor 1; Mitogen-inducible Gene 6 Protein; GENE-33; MIG-6; RALT) (Biotin); anti-ERRFI1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2B9
• Specificity: Recognizes human ERRFI1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-ERRFI1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa111-221 from human ERRFI1 (NP_061821) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VVCGFKKLTVNGVCASTPPLTPIKNSPSLFPCAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTDFLLEDSTLSDFKYDVPGRRSFRGCGQINYAYFDTPAVSAA
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(ERRFI1 monoclonal antibody, Western Blot analysis of ERRFI1 expression in HepG2.)

Related Product Information for anti-ERRFI1 antibody

Negative regulator of EGFR signaling in skin morphogenesis. Acts as a negative regulator for several EGFR family members, including ERBB2, ERBB3 and ERBB4. Inhibits EGFR catalytic activity by interfering with its dimerization. Inhibits autophosphorylation of EGFR, ERBB2 and ERBB4. Important for normal keratinocyte proliferation and differentiation. Plays a role in modulating the response to steroid hormones in the uterus. Required for normal response to progesterone in the uterus and for fertility. Mediates epithelial estrogen responses in the uterus by regulating ESR1 levels and activation. Important for regulation of endometrium cell proliferation. Important for normal prenatal and perinatal lung development.

Product Categories/Family for anti-ERRFI1 antibody

Antibodies; Oncoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 10047086
• NCBI GeneID: 54206
• NCBI Accession #: NP_061821
• NCBI GenBank Nucleotide #: NM_018948
• UniProt Accession #: Q9UJM3; Q9NTG9; Q9UD05; B2RDX9
• Molecular Weight: 50,560 Da
• NCBI Official Full Name: ERBB receptor feedback inhibitor 1
• NCBI Official Synonym Full Names: ERBB receptor feedback inhibitor 1
• NCBI Official Symbol: ERRFI1
• NCBI Official Synonym Symbols: MIG6; RALT; MIG-6; GENE-33
• NCBI Protein Information: ERBB receptor feedback inhibitor 1; mitogen-inducible gene 6 protein; receptor-associated late transducer
• UniProt Protein Name: ERBB receptor feedback inhibitor 1
• Protein Family: ERBB receptor feedback inhibitor
• UniProt Gene Name: ERRFI1
• UniProt Synonym Gene Names: MIG6; MIG-6
• UniProt Entry Name: ERRFI_HUMAN

Uniprot Description

MIG-6: Negative regulator of EGFR signaling in skin morphogenesis. Acts as a negative regulator for several EGFR family members, including ERBB2, ERBB3 and ERBB4. Inhibits EGFR catalytic activity by interfering with its dimerization. Inhibits autophosphorylation of EGFR, ERBB2 and ERBB4. Important for normal keratinocyte proliferation and differentiation. Plays a role in modulating the response to steroid hormones in the uterus. Required for normal response to progesterone in the uterus and for fertility. Mediates epithelial estrogen responses in the uterus by regulating ESR1 levels and activation. Important for regulation of endometrium cell proliferation. Important for normal prenatal and perinatal lung development. Interacts with ERBB2. Interacts with EGFR. Levels are very low in quiescent cells. Up-regulated by mitogens. Belongs to the MIG6 family.

Protein type: Tumor suppressor; Inhibitor

Chromosomal Location of Human Ortholog: 1p36

Cellular Component: extrinsic to internal side of plasma membrane; cytoplasm; nucleus

Molecular Function: protein binding; protein kinase binding

Biological Process: negative regulation of epidermal growth factor receptor activity; skin morphogenesis; response to stress; negative regulation of protein amino acid autophosphorylation; regulation of keratinocyte differentiation; alveolus development