Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human ERRFI1 Monoclonal Antibody | anti-ERRFI1 antibody

ERRFI1 (MIG6, ERBB Receptor Feedback Inhibitor 1, Mitogen-inducible Gene 6 Protein, GENE-33, MIG-6, RALT) (Biotin)

Gene Names
ERRFI1; MIG6; RALT; MIG-6; GENE-33
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ERRFI1; Monoclonal Antibody; ERRFI1 (MIG6; ERBB Receptor Feedback Inhibitor 1; Mitogen-inducible Gene 6 Protein; GENE-33; MIG-6; RALT) (Biotin); anti-ERRFI1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B9
Specificity
Recognizes human ERRFI1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ERRFI1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa111-221 from human ERRFI1 (NP_061821) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VVCGFKKLTVNGVCASTPPLTPIKNSPSLFPCAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTDFLLEDSTLSDFKYDVPGRRSFRGCGQINYAYFDTPAVSAA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(ERRFI1 monoclonal antibody, Western Blot analysis of ERRFI1 expression in HepG2.)

Western Blot (WB) (ERRFI1 monoclonal antibody, Western Blot analysis of ERRFI1 expression in HepG2.)
Related Product Information for anti-ERRFI1 antibody
Negative regulator of EGFR signaling in skin morphogenesis. Acts as a negative regulator for several EGFR family members, including ERBB2, ERBB3 and ERBB4. Inhibits EGFR catalytic activity by interfering with its dimerization. Inhibits autophosphorylation of EGFR, ERBB2 and ERBB4. Important for normal keratinocyte proliferation and differentiation. Plays a role in modulating the response to steroid hormones in the uterus. Required for normal response to progesterone in the uterus and for fertility. Mediates epithelial estrogen responses in the uterus by regulating ESR1 levels and activation. Important for regulation of endometrium cell proliferation. Important for normal prenatal and perinatal lung development.
Product Categories/Family for anti-ERRFI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,560 Da
NCBI Official Full Name
ERBB receptor feedback inhibitor 1
NCBI Official Synonym Full Names
ERBB receptor feedback inhibitor 1
NCBI Official Symbol
ERRFI1
NCBI Official Synonym Symbols
MIG6; RALT; MIG-6; GENE-33
NCBI Protein Information
ERBB receptor feedback inhibitor 1; mitogen-inducible gene 6 protein; receptor-associated late transducer
UniProt Protein Name
ERBB receptor feedback inhibitor 1
UniProt Gene Name
ERRFI1
UniProt Synonym Gene Names
MIG6; MIG-6
UniProt Entry Name
ERRFI_HUMAN

Uniprot Description

MIG-6: Negative regulator of EGFR signaling in skin morphogenesis. Acts as a negative regulator for several EGFR family members, including ERBB2, ERBB3 and ERBB4. Inhibits EGFR catalytic activity by interfering with its dimerization. Inhibits autophosphorylation of EGFR, ERBB2 and ERBB4. Important for normal keratinocyte proliferation and differentiation. Plays a role in modulating the response to steroid hormones in the uterus. Required for normal response to progesterone in the uterus and for fertility. Mediates epithelial estrogen responses in the uterus by regulating ESR1 levels and activation. Important for regulation of endometrium cell proliferation. Important for normal prenatal and perinatal lung development. Interacts with ERBB2. Interacts with EGFR. Levels are very low in quiescent cells. Up-regulated by mitogens. Belongs to the MIG6 family.

Protein type: Tumor suppressor; Inhibitor

Chromosomal Location of Human Ortholog: 1p36

Cellular Component: extrinsic to internal side of plasma membrane; cytoplasm; nucleus

Molecular Function: protein binding; protein kinase binding

Biological Process: negative regulation of epidermal growth factor receptor activity; skin morphogenesis; response to stress; negative regulation of protein amino acid autophosphorylation; regulation of keratinocyte differentiation; alveolus development

Similar Products

Product Notes

The ERRFI1 errfi1 (Catalog #AAA6141776) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ERRFI1 (MIG6, ERBB Receptor Feedback Inhibitor 1, Mitogen-inducible Gene 6 Protein, GENE-33, MIG-6, RALT) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ERRFI1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ERRFI1 errfi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ERRFI1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.